BLASTX nr result
ID: Atractylodes21_contig00034978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034978 (1183 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera] 61 6e-07 emb|CAN80405.1| hypothetical protein VITISV_006869 [Vitis vinifera] 59 2e-06 emb|CAN80126.1| hypothetical protein VITISV_013417 [Vitis vinifera] 59 2e-06 >emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera] Length = 1068 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 902 FVTSGRLISPHRSRLHPKTLEALMCAQSWLLNEIRE 1009 F T GR++S HRSRLHP TLEALMCAQSWL NE+ E Sbjct: 663 FSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEMEE 698 >emb|CAN80405.1| hypothetical protein VITISV_006869 [Vitis vinifera] Length = 340 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 902 FVTSGRLISPHRSRLHPKTLEALMCAQSWLLNEI 1003 F T GR++S HRSRLHP TLEALMCAQSWL NE+ Sbjct: 128 FSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM 161 >emb|CAN80126.1| hypothetical protein VITISV_013417 [Vitis vinifera] Length = 1266 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 902 FVTSGRLISPHRSRLHPKTLEALMCAQSWLLNEI 1003 F T GR++S HRSRLHP TLEALMCAQSWL NE+ Sbjct: 691 FSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM 724