BLASTX nr result
ID: Atractylodes21_contig00034903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034903 (1275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280094.1| PREDICTED: ketol-acid reductoisomerase, chlo... 57 8e-06 >ref|XP_002280094.1| PREDICTED: ketol-acid reductoisomerase, chloroplastic [Vitis vinifera] gi|147767264|emb|CAN69003.1| hypothetical protein VITISV_005408 [Vitis vinifera] Length = 588 Score = 57.4 bits (137), Expect = 8e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +2 Query: 368 GGSGSAMGACMVSVPMISKSPFLLDFNTSIFKKEKIKFAGYDE 496 GG+GSA+ A MVS P+I K P LLDF TS+FKKEK+ AG+DE Sbjct: 55 GGTGSALAARMVSTPLI-KPPALLDFETSVFKKEKVSLAGHDE 96