BLASTX nr result
ID: Atractylodes21_contig00034883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034883 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 71 8e-11 gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrys... 71 8e-11 ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [... 71 8e-11 ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [... 71 8e-11 ref|YP_007353810.1| hypothetical chloroplast RF2 (chloroplast) [... 71 8e-11 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 147 IPMNSIGSRNDTLEESVGSSNINKLIVSLRYLPKGKKI*E 28 IPMNSIG RNDTLEESVGSSNIN+LIVSL YLPKGKKI E Sbjct: 111 IPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKISE 150 >gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2282 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 147 IPMNSIGSRNDTLEESVGSSNINKLIVSLRYLPKGKKI*E 28 IPMNSIG RNDTLEESVGSSNIN+LIVSL YLPKGKKI E Sbjct: 111 IPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKIYE 150 >ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|452849111|ref|YP_007474789.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863250|gb|AEX99322.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863266|gb|AEX99338.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863489|gb|AEX99558.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2291 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 147 IPMNSIGSRNDTLEESVGSSNINKLIVSLRYLPKGKKI*E 28 IPMNSIG RNDTLEESVGSSNIN+LIVSL YLPKGKKI E Sbjct: 111 IPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKIYE 150 >ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298897|gb|AFA45336.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2282 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 147 IPMNSIGSRNDTLEESVGSSNINKLIVSLRYLPKGKKI*E 28 IPMNSIG RNDTLEESVGSSNIN+LIVSL YLPKGKKI E Sbjct: 111 IPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKIYE 150 >ref|YP_007353810.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298880|gb|AFA45319.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2291 Score = 71.2 bits (173), Expect = 8e-11 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -1 Query: 147 IPMNSIGSRNDTLEESVGSSNINKLIVSLRYLPKGKKI*E 28 IPMNSIG RNDTLEESVGSSNIN+LIVSL YLPKGKKI E Sbjct: 111 IPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKIYE 150