BLASTX nr result
ID: Atractylodes21_contig00034816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034816 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533941.1| 3-phosphoinositide-dependent protein kinase-... 64 2e-08 ref|NP_001234519.1| 3-phosphoinositide-dependent protein kinase-... 64 2e-08 ref|XP_002871100.1| 3-phosphoinositide-dependent protein kinase-... 62 2e-08 ref|XP_004142450.1| PREDICTED: 3-phosphoinositide-dependent prot... 63 2e-08 gb|AAG51370.1|AC011560_2 putative 3-phosphoinositide-dependent p... 62 5e-08 >ref|XP_002533941.1| 3-phosphoinositide-dependent protein kinase-1, putative [Ricinus communis] gi|223526096|gb|EEF28448.1| 3-phosphoinositide-dependent protein kinase-1, putative [Ricinus communis] Length = 506 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KDSRITVLPNASSDDKACTFVGTAAYVPPEV 94 +DSRITVLPNA+SDDKACTFVGTAAYVPPEV Sbjct: 210 QDSRITVLPNAASDDKACTFVGTAAYVPPEV 240 >ref|NP_001234519.1| 3-phosphoinositide-dependent protein kinase-1 [Solanum lycopersicum] gi|57168305|gb|AAW38936.1| 3-phosphoinositide-dependent protein kinase-1 [Solanum lycopersicum] Length = 494 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KDSRITVLPNASSDDKACTFVGTAAYVPPEV 94 +DSRITVLPNA+SDDKACTFVGTAAYVPPEV Sbjct: 197 QDSRITVLPNAASDDKACTFVGTAAYVPPEV 227 >ref|XP_002871100.1| 3-phosphoinositide-dependent protein kinase-1 PDK1 [Arabidopsis lyrata subsp. lyrata] gi|297316937|gb|EFH47359.1| 3-phosphoinositide-dependent protein kinase-1 PDK1 [Arabidopsis lyrata subsp. lyrata] Length = 485 Score = 62.0 bits (149), Expect(2) = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 2 KDSRITVLPNASSDDKACTFVGTAAYVPPEV 94 +DS+ITVLPNA+SDDKACTFVGTAAYVPPEV Sbjct: 187 QDSQITVLPNAASDDKACTFVGTAAYVPPEV 217 Score = 21.2 bits (43), Expect(2) = 2e-08 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 96 LNSSPATIG 122 LNSSPAT+G Sbjct: 218 LNSSPATVG 226 >ref|XP_004142450.1| PREDICTED: 3-phosphoinositide-dependent protein kinase 1-like [Cucumis sativus] gi|449513224|ref|XP_004164266.1| PREDICTED: 3-phosphoinositide-dependent protein kinase 1-like [Cucumis sativus] Length = 489 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 5 DSRITVLPNASSDDKACTFVGTAAYVPPEV 94 DSRITVLPNA+SDDKACTFVGTAAYVPPEV Sbjct: 194 DSRITVLPNAASDDKACTFVGTAAYVPPEV 223 >gb|AAG51370.1|AC011560_2 putative 3-phosphoinositide-dependent protein kinase-1; 57432-54928 [Arabidopsis thaliana] gi|8567784|gb|AAF76356.1| 3-phosphoinositide-dependent protein kinase-1, putative [Arabidopsis thaliana] Length = 483 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 2 KDSRITVLPNASSDDKACTFVGTAAYVPPEV 94 +DS+ITVLPNA+SDDKACTFVGTAAYVPPEV Sbjct: 191 QDSQITVLPNAASDDKACTFVGTAAYVPPEV 221