BLASTX nr result
ID: Atractylodes21_contig00034775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034775 (697 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX88470.1| Pirin1 [Triphysaria versicolor] 82 8e-14 ref|XP_003552752.1| PREDICTED: pirin-like protein-like [Glycine ... 80 4e-13 ref|NP_001234292.1| pirin-like protein [Solanum lycopersicum] gi... 80 5e-13 ref|XP_002302888.1| predicted protein [Populus trichocarpa] gi|2... 80 5e-13 ref|XP_003532322.1| PREDICTED: pirin-like protein-like [Glycine ... 79 7e-13 >gb|AEX88470.1| Pirin1 [Triphysaria versicolor] Length = 317 Score = 82.4 bits (202), Expect = 8e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +2 Query: 101 FTAPRLVAKKVLAKSQSEGDGAVVRRSIGRPELKSLDPFLMLDEFS 238 F PR+VAKK+LAKSQSEGDGA+VRRSIGRPELKSLDPFL+LDEF+ Sbjct: 33 FQQPRIVAKKILAKSQSEGDGALVRRSIGRPELKSLDPFLLLDEFA 78 >ref|XP_003552752.1| PREDICTED: pirin-like protein-like [Glycine max] Length = 324 Score = 80.1 bits (196), Expect = 4e-13 Identities = 41/55 (74%), Positives = 43/55 (78%) Frame = +2 Query: 74 MTTSSEILGFTAPRLVAKKVLAKSQSEGDGAVVRRSIGRPELKSLDPFLMLDEFS 238 M+ S FT PRLV KKVLAKSQ EGDGAVVRR IGR ELK+LDPFLMLD FS Sbjct: 30 MSQSDHSSAFTTPRLVLKKVLAKSQHEGDGAVVRRGIGRSELKNLDPFLMLDHFS 84 >ref|NP_001234292.1| pirin-like protein [Solanum lycopersicum] gi|14195017|sp|Q9SEE4.1|PIRL_SOLLC RecName: Full=Pirin-like protein gi|6651245|gb|AAF22236.1|AF154003_1 pirin [Solanum lycopersicum] Length = 291 Score = 79.7 bits (195), Expect = 5e-13 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = +2 Query: 101 FTAPRLVAKKVLAKSQSEGDGAVVRRSIGRPELKSLDPFLMLDEFS 238 F+ PRLV KKVLA++Q+EGDGA+VRRSIGRPEL++LDPFLMLDEFS Sbjct: 7 FSRPRLVVKKVLARAQNEGDGAIVRRSIGRPELQNLDPFLMLDEFS 52 >ref|XP_002302888.1| predicted protein [Populus trichocarpa] gi|222844614|gb|EEE82161.1| predicted protein [Populus trichocarpa] Length = 294 Score = 79.7 bits (195), Expect = 5e-13 Identities = 40/55 (72%), Positives = 45/55 (81%) Frame = +2 Query: 74 MTTSSEILGFTAPRLVAKKVLAKSQSEGDGAVVRRSIGRPELKSLDPFLMLDEFS 238 M+ S + GF+ PRLV KKVLAK Q EG+GAVVRRSIGR ELK LDPFLMLD+FS Sbjct: 1 MSESDQSTGFSTPRLVTKKVLAKLQHEGEGAVVRRSIGRSELKFLDPFLMLDDFS 55 >ref|XP_003532322.1| PREDICTED: pirin-like protein-like [Glycine max] Length = 325 Score = 79.3 bits (194), Expect = 7e-13 Identities = 41/55 (74%), Positives = 43/55 (78%) Frame = +2 Query: 74 MTTSSEILGFTAPRLVAKKVLAKSQSEGDGAVVRRSIGRPELKSLDPFLMLDEFS 238 M+ S FT PRLV KKVLAKSQ EGDGAVVRR IGR ELK+LDPFLMLD FS Sbjct: 32 MSQSDNSSPFTTPRLVLKKVLAKSQHEGDGAVVRRGIGRSELKNLDPFLMLDHFS 86