BLASTX nr result
ID: Atractylodes21_contig00034578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034578 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611470.1| NAC domain protein [Medicago truncatula] gi|... 72 4e-11 ref|XP_002280894.2| PREDICTED: NAC domain-containing protein 68-... 71 8e-11 emb|CAN78113.1| hypothetical protein VITISV_004432 [Vitis vinifera] 71 8e-11 ref|XP_003524716.1| PREDICTED: protein BEARSKIN1-like [Glycine max] 71 1e-10 ref|XP_003549977.1| PREDICTED: protein BEARSKIN1-like [Glycine max] 70 2e-10 >ref|XP_003611470.1| NAC domain protein [Medicago truncatula] gi|355512805|gb|AES94428.1| NAC domain protein [Medicago truncatula] Length = 342 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +2 Query: 200 MGGASLPPGFRFHPTDEELIGYYLKRKVEGLKSEL 304 MGGASLPPGFRFHPTDEELIGYYLKRKVEGL+ EL Sbjct: 1 MGGASLPPGFRFHPTDEELIGYYLKRKVEGLEIEL 35 >ref|XP_002280894.2| PREDICTED: NAC domain-containing protein 68-like [Vitis vinifera] gi|297742117|emb|CBI33904.3| unnamed protein product [Vitis vinifera] Length = 365 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 200 MGGASLPPGFRFHPTDEELIGYYLKRKVEGLKSEL 304 MGGASLPPGFRFHPTDEEL+GYYLKRKVEG K EL Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVEGQKFEL 35 >emb|CAN78113.1| hypothetical protein VITISV_004432 [Vitis vinifera] Length = 365 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 200 MGGASLPPGFRFHPTDEELIGYYLKRKVEGLKSEL 304 MGGASLPPGFRFHPTDEEL+GYYLKRKVEG K EL Sbjct: 1 MGGASLPPGFRFHPTDEELVGYYLKRKVEGQKFEL 35 >ref|XP_003524716.1| PREDICTED: protein BEARSKIN1-like [Glycine max] Length = 345 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 200 MGGASLPPGFRFHPTDEELIGYYLKRKVEGLKSEL 304 MGGA+LPPGFRFHPTDEEL+GYYLKRKVEGL+ EL Sbjct: 1 MGGATLPPGFRFHPTDEELVGYYLKRKVEGLEIEL 35 >ref|XP_003549977.1| PREDICTED: protein BEARSKIN1-like [Glycine max] Length = 342 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +2 Query: 200 MGGASLPPGFRFHPTDEELIGYYLKRKVEGLKSEL 304 MGGA+LPPGFRFHPTDEEL+GYYLKRKVEG++ EL Sbjct: 1 MGGATLPPGFRFHPTDEELVGYYLKRKVEGIEIEL 35