BLASTX nr result
ID: Atractylodes21_contig00034483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034483 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO32896.1| hypothetical protein [Amblyomma maculatum] 63 3e-08 emb|CBI19009.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002513750.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_002285862.1| PREDICTED: acetyltransferase At1g77540 [Viti... 58 7e-07 ref|NP_001241296.1| uncharacterized protein LOC100778176 [Glycin... 58 9e-07 >gb|AEO32896.1| hypothetical protein [Amblyomma maculatum] Length = 141 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 VIPTCSYISDTFLPRNPSWKSVLYSEDLKSSI 98 VIPTCSYISDTFLPRNPSW +V+Y+E+LKSSI Sbjct: 110 VIPTCSYISDTFLPRNPSWSAVVYTEELKSSI 141 >emb|CBI19009.3| unnamed protein product [Vitis vinifera] Length = 67 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 VIPTCSYISDTFLPRNPSWKSVLYSEDLKSSI 98 VIP+CSY+SDTFLPRNPSW S++YSE+ KSS+ Sbjct: 36 VIPSCSYVSDTFLPRNPSWNSLVYSEEPKSSM 67 >ref|XP_002513750.1| conserved hypothetical protein [Ricinus communis] gi|223546836|gb|EEF48333.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 VIPTCSYISDTFLPRNPSWKSVLYSEDLKSSI 98 VIP+CSY+SDTFLPRN SW SV++SED+KS+I Sbjct: 81 VIPSCSYVSDTFLPRNESWNSVVFSEDIKSNI 112 >ref|XP_002285862.1| PREDICTED: acetyltransferase At1g77540 [Vitis vinifera] Length = 111 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 VIPTCSYISDTFLPRNPSWKSVLYSEDLKSSI 98 VIP+CSY+SDTFLPRNPSW S++YSE+ KSS+ Sbjct: 80 VIPSCSYVSDTFLPRNPSWNSLVYSEEPKSSM 111 >ref|NP_001241296.1| uncharacterized protein LOC100778176 [Glycine max] gi|255638882|gb|ACU19743.1| unknown [Glycine max] Length = 117 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 VIPTCSYISDTFLPRNPSWKSVLYSEDLKSSI 98 +IPTCSY+SDTFLPRNPSW SV+Y+E KS+I Sbjct: 86 IIPTCSYVSDTFLPRNPSWNSVVYTEGGKSNI 117