BLASTX nr result
ID: Atractylodes21_contig00034463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034463 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|2235... 57 2e-06 >ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|223536127|gb|EEF37782.1| auxilin, putative [Ricinus communis] Length = 983 Score = 57.0 bits (136), Expect = 2e-06 Identities = 35/85 (41%), Positives = 43/85 (50%), Gaps = 5/85 (5%) Frame = -1 Query: 241 SQQSDHFVDLLGNLG--QTEKAESPRHHSDKSPRGLDDLIPGFGSGSPASSNRWNSEPS- 71 + S F DLLGN G +TE +K DDL+PGFG S S R SE + Sbjct: 163 TSSSSPFDDLLGNFGKLETESKRETTPEVEKDSAMFDDLLPGFGRSSSPSIARSTSESTR 222 Query: 70 --PKSTGKTKEKSNAMDDPFVVLES 2 ST K SN M+DPFV+L+S Sbjct: 223 AQKSSTNSVKTASNMMEDPFVILQS 247