BLASTX nr result
ID: Atractylodes21_contig00034436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034436 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303939.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|NP_171835.1| exosome complex component RRP4 [Arabidopsis tha... 59 5e-07 ref|XP_003554237.1| PREDICTED: exosome complex component RRP4-li... 58 7e-07 gb|ACU18895.1| unknown [Glycine max] 58 7e-07 ref|XP_002271258.1| PREDICTED: exosome complex component rrp4-li... 57 1e-06 >ref|XP_002303939.1| predicted protein [Populus trichocarpa] gi|222841371|gb|EEE78918.1| predicted protein [Populus trichocarpa] Length = 320 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -2 Query: 214 LDVILDVVDLSSSKGLDIHEMLGAEFYVLVAEREAERRNSSTRRK 80 L+VIL+ +DLSS+ L I EMLG EF+VLVAEREAERR S T+RK Sbjct: 275 LEVILETIDLSSTLNLGIDEMLGPEFHVLVAEREAERRTSMTKRK 319 >ref|NP_171835.1| exosome complex component RRP4 [Arabidopsis thaliana] gi|3850568|gb|AAC72108.1| Similar to hypothetical protein SPAC2F7.14c gi|1052797 from Schizosaccharomyces pombe cosmid gb|Z50142 [Arabidopsis thaliana] gi|34365689|gb|AAQ65156.1| At1g03360 [Arabidopsis thaliana] gi|51970606|dbj|BAD43995.1| hypothetical protein [Arabidopsis thaliana] gi|332189442|gb|AEE27563.1| exosome complex component RRP4 [Arabidopsis thaliana] Length = 322 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/46 (60%), Positives = 40/46 (86%) Frame = -2 Query: 214 LDVILDVVDLSSSKGLDIHEMLGAEFYVLVAEREAERRNSSTRRKR 77 L+VI++ V+LS+SK +DIH+MLG+EF+V+VAE EAERR T+RK+ Sbjct: 279 LEVIMETVNLSNSKNIDIHDMLGSEFHVVVAENEAERRR--TKRKK 322 >ref|XP_003554237.1| PREDICTED: exosome complex component RRP4-like [Glycine max] Length = 327 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 214 LDVILDVVDLSSSKGLDIHEMLGAEFYVLVAEREAERRNSSTRRK 80 L++I ++DLS S LDIH+MLG+EF VLVAE+EAERR+S +R+ Sbjct: 283 LEIIKGIIDLSLSMNLDIHDMLGSEFCVLVAEKEAERRSSMKKRR 327 >gb|ACU18895.1| unknown [Glycine max] Length = 199 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = -2 Query: 214 LDVILDVVDLSSSKGLDIHEMLGAEFYVLVAEREAERRNSSTRRK 80 L++I ++DLS S LDIH+MLG+EF VLVAE+EAERR+S +R+ Sbjct: 155 LEIIKGIIDLSLSMNLDIHDMLGSEFCVLVAEKEAERRSSMKKRR 199 >ref|XP_002271258.1| PREDICTED: exosome complex component rrp4-like [Vitis vinifera] Length = 330 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 214 LDVILDVVDLSSSKGLDIHEMLGAEFYVLVAEREAERRNSSTRRK 80 ++VI + V+LSSS LDIHEMLG+EFYVLVAE EA R++ T++K Sbjct: 285 VEVIKETVNLSSSLNLDIHEMLGSEFYVLVAEGEATRKSMFTKKK 329