BLASTX nr result
ID: Atractylodes21_contig00034334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034334 (625 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S... 64 2e-08 ref|XP_002528203.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 122 REPFQKFSTAKAEPKPRRGFGNSFQPAIDAPRLLPH 15 REPFQKFS AK +P P+RGFGNSFQPAIDAPRL PH Sbjct: 59 REPFQKFSKAKGKPGPKRGFGNSFQPAIDAPRLEPH 94 >gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S cerevisiae. EST gb|N96627 comes from this gene [Arabidopsis thaliana] Length = 573 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 122 REPFQKFSTAKAEPKPRRGFGNSFQPAIDAPRLLPH 15 REPFQKFS A+ + +PRRGFGNSFQPAIDAPRL PH Sbjct: 538 REPFQKFSKAQDKLRPRRGFGNSFQPAIDAPRLRPH 573 >ref|XP_002528203.1| conserved hypothetical protein [Ricinus communis] gi|223532415|gb|EEF34210.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 122 REPFQKFSTAKAEPKPRRGFGNSFQPAIDAPRLLPH 15 +EPFQKFS A+ P+P+RGFGNSFQPAIDAPRL PH Sbjct: 16 KEPFQKFSKAEDVPRPKRGFGNSFQPAIDAPRLEPH 51