BLASTX nr result
ID: Atractylodes21_contig00034266
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034266 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309354.1| predicted protein [Populus trichocarpa] gi|2... 55 4e-06 >ref|XP_002309354.1| predicted protein [Populus trichocarpa] gi|222855330|gb|EEE92877.1| predicted protein [Populus trichocarpa] Length = 291 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +1 Query: 1 FWCEMCEVGAFSEKVMNNHKGGKKHLRRLVQVLRKGKMEGEAPATCDTEEEKSE 162 FWCEMC++GA+SE VM HK GKKHL R L+K GEA D + + SE Sbjct: 175 FWCEMCQIGAYSEMVMEAHKKGKKHLAR----LQKSSQNGEA-VQADKKAKDSE 223