BLASTX nr result
ID: Atractylodes21_contig00034248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034248 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629173.1| Polynucleotidyl transferase [Medicago trunca... 59 5e-07 >ref|XP_003629173.1| Polynucleotidyl transferase [Medicago truncatula] gi|355523195|gb|AET03649.1| Polynucleotidyl transferase [Medicago truncatula] Length = 169 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 6/67 (8%) Frame = -1 Query: 225 STSPKSTTPYHPALTVSNIRTFIPSTLDIEKVQYASWAELFKIHVRAFQVSDHIQP---- 58 S+S S T +HPA VSNI+ I L++EK QY +WAELF+I R+ +V H P Sbjct: 31 SSSTYSKTKFHPAFAVSNIKNHIHIVLEMEKDQYGTWAELFRILARSHRVLHHGVPSKDN 90 Query: 57 --PRDTS 43 PRDTS Sbjct: 91 TTPRDTS 97