BLASTX nr result
ID: Atractylodes21_contig00034101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00034101 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15896.3| unnamed protein product [Vitis vinifera] 109 2e-22 ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containi... 109 2e-22 ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 ref|XP_002533891.1| pentatricopeptide repeat-containing protein,... 103 2e-20 ref|NP_187518.1| pentatricopeptide repeat-containing protein [Ar... 102 4e-20 >emb|CBI15896.3| unnamed protein product [Vitis vinifera] Length = 650 Score = 109 bits (273), Expect = 2e-22 Identities = 56/94 (59%), Positives = 69/94 (73%) Frame = -3 Query: 286 MAELAKALCPKHLLKLLKSEKDSISALSLFDSAISNPNYTPTPSVFHHILRRISQSPKLL 107 MA K+L PK ++KLLKSEK+ SALS+FDS P Y+ TP VFHHIL+R+ PKL+ Sbjct: 1 MASAPKSLSPKRVIKLLKSEKNPHSALSIFDSVTRFPGYSHTPYVFHHILKRLF-DPKLV 59 Query: 106 PHVSRIVNLIQAKKCTCSEDIPLIVIKAYSNNSM 5 HVSRIV LI+ +KC C ED+ L VIKAY+ NSM Sbjct: 60 AHVSRIVELIRTQKCKCPEDVALTVIKAYAKNSM 93 >ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060 [Vitis vinifera] Length = 691 Score = 109 bits (273), Expect = 2e-22 Identities = 56/94 (59%), Positives = 69/94 (73%) Frame = -3 Query: 286 MAELAKALCPKHLLKLLKSEKDSISALSLFDSAISNPNYTPTPSVFHHILRRISQSPKLL 107 MA K+L PK ++KLLKSEK+ SALS+FDS P Y+ TP VFHHIL+R+ PKL+ Sbjct: 1 MASAPKSLSPKRVIKLLKSEKNPHSALSIFDSVTRFPGYSHTPYVFHHILKRLF-DPKLV 59 Query: 106 PHVSRIVNLIQAKKCTCSEDIPLIVIKAYSNNSM 5 HVSRIV LI+ +KC C ED+ L VIKAY+ NSM Sbjct: 60 AHVSRIVELIRTQKCKCPEDVALTVIKAYAKNSM 93 >ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] gi|449516585|ref|XP_004165327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] Length = 701 Score = 103 bits (258), Expect = 1e-20 Identities = 52/94 (55%), Positives = 69/94 (73%) Frame = -3 Query: 286 MAELAKALCPKHLLKLLKSEKDSISALSLFDSAISNPNYTPTPSVFHHILRRISQSPKLL 107 M EL K + P +LKLLK+EK+ +AL++FDSA +P Y P VFHHILRR+ PKL+ Sbjct: 1 MVELPKVISPTLVLKLLKAEKNPNAALAIFDSACQHPGYAHPPFVFHHILRRL-MDPKLV 59 Query: 106 PHVSRIVNLIQAKKCTCSEDIPLIVIKAYSNNSM 5 HV RIV+L++A++CTCSED+ L IKAY+ SM Sbjct: 60 VHVGRIVDLMRAQRCTCSEDVALSAIKAYAKCSM 93 >ref|XP_002533891.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526155|gb|EEF28491.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 701 Score = 103 bits (256), Expect = 2e-20 Identities = 52/96 (54%), Positives = 73/96 (76%) Frame = -3 Query: 292 ASMAELAKALCPKHLLKLLKSEKDSISALSLFDSAISNPNYTPTPSVFHHILRRISQSPK 113 A+ AEL ++L K LLKLLK+EK+ +SALSLF+SA N +++ VFHHILRR++ + Sbjct: 2 AAAAELTRSLSSKLLLKLLKAEKNPLSALSLFESASRNKSHSA--HVFHHILRRLAADSR 59 Query: 112 LLPHVSRIVNLIQAKKCTCSEDIPLIVIKAYSNNSM 5 L+ HVSRIV++++A+KC C ED+ L VIKAY+ N M Sbjct: 60 LVSHVSRIVDIVKAQKCPCKEDVALTVIKAYAKNKM 95 >ref|NP_187518.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207466|sp|Q9SS81.1|PP221_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g09060 gi|5923671|gb|AAD56322.1|AC009326_9 hypothetical protein [Arabidopsis thaliana] gi|332641194|gb|AEE74715.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 687 Score = 102 bits (253), Expect = 4e-20 Identities = 50/94 (53%), Positives = 69/94 (73%) Frame = -3 Query: 286 MAELAKALCPKHLLKLLKSEKDSISALSLFDSAISNPNYTPTPSVFHHILRRISQSPKLL 107 M K+L PKH+LKLLKSEK+ +A +LFDSA +P Y + V+HHILRR+S++ +++ Sbjct: 1 MVVFPKSLSPKHVLKLLKSEKNPRAAFALFDSATRHPGYAHSAVVYHHILRRLSET-RMV 59 Query: 106 PHVSRIVNLIQAKKCTCSEDIPLIVIKAYSNNSM 5 HVSRIV LI++++C C ED+ L VIK Y NSM Sbjct: 60 NHVSRIVELIRSQECKCDEDVALSVIKTYGKNSM 93