BLASTX nr result
ID: Atractylodes21_contig00033891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033891 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01928.1| hypothetical protein [Beta vulgaris] 115 2e-28 gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris ... 114 4e-27 gb|AEV42261.1| hypothetical protein [Beta vulgaris] 108 9e-27 ref|XP_004150327.1| PREDICTED: uncharacterized protein LOC101216... 108 1e-25 emb|CAN66553.1| hypothetical protein VITISV_018166 [Vitis vinifera] 103 3e-24 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 115 bits (287), Expect(2) = 2e-28 Identities = 51/68 (75%), Positives = 63/68 (92%) Frame = -2 Query: 205 FLALKHPFNATSVAALFIKEVVRLHGFPSSIVTDRDKVFMSIFWRELFRLQGSTLLRSTA 26 F+ LKHPF A +VAA+FIKE+V+LHGFPS+IV+DRDKVFMS+FW+ELF+LQG+ L RSTA Sbjct: 1208 FITLKHPFTAPTVAAVFIKEIVKLHGFPSTIVSDRDKVFMSLFWKELFKLQGTLLHRSTA 1267 Query: 25 YHPQTDGQ 2 YHPQ+DGQ Sbjct: 1268 YHPQSDGQ 1275 Score = 35.4 bits (80), Expect(2) = 2e-28 Identities = 13/21 (61%), Positives = 19/21 (90%) Frame = -3 Query: 267 PRSNGYDTVLVVLDRLTKFGH 205 P+S G+DT+LVV+DRL+K+ H Sbjct: 1187 PKSQGWDTILVVVDRLSKYAH 1207 >gb|AFK13856.1| Ty3/gypsy retrotransposon protein [Beta vulgaris subsp. vulgaris] Length = 1631 Score = 114 bits (285), Expect(2) = 4e-27 Identities = 51/68 (75%), Positives = 61/68 (89%) Frame = -2 Query: 205 FLALKHPFNATSVAALFIKEVVRLHGFPSSIVTDRDKVFMSIFWRELFRLQGSTLLRSTA 26 FL L+HPF A VA LF+KEVVRLHGFPSSIV+DRD++F+S+FW+ELFRL G+TL RS+A Sbjct: 1275 FLTLRHPFTALMVADLFVKEVVRLHGFPSSIVSDRDRIFLSLFWKELFRLHGTTLKRSSA 1334 Query: 25 YHPQTDGQ 2 YHPQTDGQ Sbjct: 1335 YHPQTDGQ 1342 Score = 32.0 bits (71), Expect(2) = 4e-27 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -3 Query: 267 PRSNGYDTVLVVLDRLTKFGH 205 P S G DT+LV++DRL+K+ H Sbjct: 1254 PVSKGVDTILVIVDRLSKYAH 1274 >gb|AEV42261.1| hypothetical protein [Beta vulgaris] Length = 1396 Score = 108 bits (271), Expect(2) = 9e-27 Identities = 49/68 (72%), Positives = 61/68 (89%) Frame = -2 Query: 205 FLALKHPFNATSVAALFIKEVVRLHGFPSSIVTDRDKVFMSIFWRELFRLQGSTLLRSTA 26 F+ L+HPF+A +VA +FIKEVV+LHGFP++IV+DRDKVFMSIFW+ELF+LQ + L RSTA Sbjct: 1044 FIGLRHPFSAATVAQVFIKEVVKLHGFPTTIVSDRDKVFMSIFWKELFKLQRTLLHRSTA 1103 Query: 25 YHPQTDGQ 2 YHPQ DGQ Sbjct: 1104 YHPQLDGQ 1111 Score = 36.2 bits (82), Expect(2) = 9e-27 Identities = 13/21 (61%), Positives = 20/21 (95%) Frame = -3 Query: 267 PRSNGYDTVLVVLDRLTKFGH 205 P+S G+D++LVV+DRL+K+GH Sbjct: 1023 PKSGGWDSILVVVDRLSKYGH 1043 >ref|XP_004150327.1| PREDICTED: uncharacterized protein LOC101216833 [Cucumis sativus] Length = 2712 Score = 108 bits (271), Expect(2) = 1e-25 Identities = 49/68 (72%), Positives = 59/68 (86%) Frame = -2 Query: 205 FLALKHPFNATSVAALFIKEVVRLHGFPSSIVTDRDKVFMSIFWRELFRLQGSTLLRSTA 26 FLALKHPF A +VA +F+KE+VRLHGFP SIV+DRDKVF+S FW+ +F+L G+ L RSTA Sbjct: 2123 FLALKHPFTAKTVAEIFVKEIVRLHGFPKSIVSDRDKVFVSSFWKGMFKLAGTKLNRSTA 2182 Query: 25 YHPQTDGQ 2 YHPQTDGQ Sbjct: 2183 YHPQTDGQ 2190 Score = 32.3 bits (72), Expect(2) = 1e-25 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = -3 Query: 267 PRSNGYDTVLVVLDRLTKFGH 205 P+S G++T+ VV+DR +K+GH Sbjct: 2102 PKSCGFETIFVVVDRFSKYGH 2122 >emb|CAN66553.1| hypothetical protein VITISV_018166 [Vitis vinifera] Length = 1448 Score = 103 bits (258), Expect(2) = 3e-24 Identities = 47/68 (69%), Positives = 58/68 (85%) Frame = -2 Query: 205 FLALKHPFNATSVAALFIKEVVRLHGFPSSIVTDRDKVFMSIFWRELFRLQGSTLLRSTA 26 F LKHPF A +VAA+F+++VV+LHGFP SI++DRDKVF+S FW ELFRLQG++L STA Sbjct: 684 FSLLKHPFXAQTVAAIFVRDVVKLHGFPRSIISDRDKVFLSRFWIELFRLQGTSLXHSTA 743 Query: 25 YHPQTDGQ 2 YH QTDGQ Sbjct: 744 YHXQTDGQ 751 Score = 32.7 bits (73), Expect(2) = 3e-24 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -3 Query: 267 PRSNGYDTVLVVLDRLTKFGH 205 P+S GY+ +LVV+DRL+K+ H Sbjct: 663 PKSEGYNFILVVVDRLSKYAH 683