BLASTX nr result
ID: Atractylodes21_contig00033831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033831 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270419.1| PREDICTED: phosphatidylinositol-4-phosphate ... 57 2e-06 >ref|XP_002270419.1| PREDICTED: phosphatidylinositol-4-phosphate 5-kinase 8-like [Vitis vinifera] Length = 789 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +2 Query: 272 MSEEINLHGDVYFGNVKGKIPHGMGRYTWSDGTVY 376 +SE++ +GD+Y GN KG PHG G+YTWSDGTVY Sbjct: 7 LSEKVFSNGDIYVGNFKGVFPHGKGKYTWSDGTVY 41