BLASTX nr result
ID: Atractylodes21_contig00033787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033787 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36530.3| unnamed protein product [Vitis vinifera] 96 2e-18 ref|XP_002278700.1| PREDICTED: transmembrane 9 superfamily membe... 96 2e-18 ref|XP_003518221.1| PREDICTED: transmembrane 9 superfamily membe... 93 2e-17 ref|XP_002515423.1| Endosomal P24A protein precursor, putative [... 92 3e-17 ref|XP_003550684.1| PREDICTED: transmembrane 9 superfamily membe... 92 4e-17 >emb|CBI36530.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 96.3 bits (238), Expect = 2e-18 Identities = 54/93 (58%), Positives = 58/93 (62%) Frame = -1 Query: 281 HLSIFVFLLLSIHGQSFYLPGVXXXXXXXXXXXXXXXXXXXXXYLPGVAPQDFFKGDVLK 102 HL IF+ LLL H +SFYLPG VAPQDF KGD LK Sbjct: 17 HLWIFLSLLLFPHVRSFYLPG--------------------------VAPQDFNKGDPLK 50 Query: 101 VKVNKLASTKTQLPYSYYSIPYCRPQEIVDSAE 3 VKVNKL STKTQLPYSYYS+PYCRP+ IVDSAE Sbjct: 51 VKVNKLTSTKTQLPYSYYSLPYCRPETIVDSAE 83 >ref|XP_002278700.1| PREDICTED: transmembrane 9 superfamily member 4 isoform 1 [Vitis vinifera] Length = 646 Score = 96.3 bits (238), Expect = 2e-18 Identities = 54/93 (58%), Positives = 58/93 (62%) Frame = -1 Query: 281 HLSIFVFLLLSIHGQSFYLPGVXXXXXXXXXXXXXXXXXXXXXYLPGVAPQDFFKGDVLK 102 HL IF+ LLL H +SFYLPG VAPQDF KGD LK Sbjct: 17 HLWIFLSLLLFPHVRSFYLPG--------------------------VAPQDFNKGDPLK 50 Query: 101 VKVNKLASTKTQLPYSYYSIPYCRPQEIVDSAE 3 VKVNKL STKTQLPYSYYS+PYCRP+ IVDSAE Sbjct: 51 VKVNKLTSTKTQLPYSYYSLPYCRPETIVDSAE 83 >ref|XP_003518221.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine max] Length = 642 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 152 YLPGVAPQDFFKGDVLKVKVNKLASTKTQLPYSYYSIPYCRPQEIVDSAE 3 YLPGVAP+DF+KGD LKVKVNKL STKTQLPYSYYS+PYCRP+ I DSAE Sbjct: 29 YLPGVAPEDFWKGDPLKVKVNKLTSTKTQLPYSYYSLPYCRPKHIFDSAE 78 >ref|XP_002515423.1| Endosomal P24A protein precursor, putative [Ricinus communis] gi|223545367|gb|EEF46872.1| Endosomal P24A protein precursor, putative [Ricinus communis] Length = 645 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -1 Query: 152 YLPGVAPQDFFKGDVLKVKVNKLASTKTQLPYSYYSIPYCRPQEIVDSAE 3 YLPGVAP+DF KGD LKVKVNKL STKTQLPYSYYS+PYC P +IVDSAE Sbjct: 32 YLPGVAPEDFVKGDELKVKVNKLTSTKTQLPYSYYSLPYCHPSKIVDSAE 81 >ref|XP_003550684.1| PREDICTED: transmembrane 9 superfamily member 4-like [Glycine max] Length = 642 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 152 YLPGVAPQDFFKGDVLKVKVNKLASTKTQLPYSYYSIPYCRPQEIVDSAE 3 YLPGVAP+DF+KGD L+VKVNKL STKTQLPYSYYS+PYCRP+ I DSAE Sbjct: 29 YLPGVAPEDFWKGDPLRVKVNKLTSTKTQLPYSYYSLPYCRPKHIFDSAE 78