BLASTX nr result
ID: Atractylodes21_contig00033667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033667 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC26250.1| contains similarity to reverse transcriptase (Pfa... 135 3e-30 gb|ABG22008.1| retrotransposon protein, putative, Ty1-copia subc... 135 3e-30 gb|ABA97342.2| retrotransposon protein, putative, Ty1-copia subc... 135 3e-30 gb|AAO37490.1| putative gag-pol polyprotein [Oryza sativa Japoni... 134 8e-30 gb|ABF96975.1| retrotransposon protein, putative, Ty1-copia subc... 134 8e-30 >gb|AAC26250.1| contains similarity to reverse transcriptase (Pfam: rvt.hmm, score 19.29) [Arabidopsis thaliana] gi|7267136|emb|CAB80804.1| putative retrotransposon protein [Arabidopsis thaliana] Length = 964 Score = 135 bits (341), Expect = 3e-30 Identities = 60/105 (57%), Positives = 75/105 (71%) Frame = -2 Query: 316 LPIRFWGYALETAARILNLVPTKKVSKTPYETWFGKTPSLKYLRVWGCEAYVRRETQDKL 137 LP FWGYALET+A +LN P+K V KTPYE W GK P+L +L++WGCE+Y +R DKL Sbjct: 264 LPSPFWGYALETSAFMLNRCPSKSVEKTPYEIWTGKVPNLSFLKIWGCESYAKRLITDKL 323 Query: 136 EPRSEKVVFIGYPTTSYGYIFYKPSENKVFVSRGAVFLERNMLLK 2 P+S+K F+GYP + GY FY P++NKVFV R FLER L K Sbjct: 324 GPKSDKCYFVGYPKETKGYYFYHPTDNKVFVVRNGAFLEREFLSK 368 >gb|ABG22008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza sativa Japonica Group] Length = 932 Score = 135 bits (341), Expect = 3e-30 Identities = 60/106 (56%), Positives = 76/106 (71%) Frame = -2 Query: 325 RASLPIRFWGYALETAARILNLVPTKKVSKTPYETWFGKTPSLKYLRVWGCEAYVRRETQ 146 + LP+ FWGYALETAA LN VP+K + KTPYE W GK PSL +L++WGCE YV+R Sbjct: 288 QTDLPLSFWGYALETAAFTLNRVPSKSLDKTPYEIWTGKRPSLSFLKIWGCEVYVKRLQS 347 Query: 145 DKLEPRSEKVVFIGYPTTSYGYIFYKPSENKVFVSRGAVFLERNML 8 DKL P+S+K F+GYP + GY FY E+KVFV+R VFLE+ + Sbjct: 348 DKLTPKSDKYFFVGYPKETKGYYFYNREEDKVFVARHDVFLEKEFI 393 >gb|ABA97342.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza sativa Japonica Group] Length = 1050 Score = 135 bits (340), Expect = 3e-30 Identities = 60/108 (55%), Positives = 76/108 (70%) Frame = -2 Query: 325 RASLPIRFWGYALETAARILNLVPTKKVSKTPYETWFGKTPSLKYLRVWGCEAYVRRETQ 146 + LP+ FW YALE AA LN VP+K V+KTPYE W GK PSL +L++WGCE YV+R Sbjct: 413 QTDLPLSFWAYALEKAAFTLNKVPSKSVNKTPYEIWTGKRPSLSFLKIWGCEVYVKRLQS 472 Query: 145 DKLEPRSEKVVFIGYPTTSYGYIFYKPSENKVFVSRGAVFLERNMLLK 2 DKL P+S+K F+GYP + GY FY E KVFV+R VFLE+ +L+ Sbjct: 473 DKLTPKSDKCFFVGYPKETKGYYFYNREEGKVFVARHGVFLEKEFILR 520 >gb|AAO37490.1| putative gag-pol polyprotein [Oryza sativa Japonica Group] gi|41393192|gb|AAS01915.1| putative polyprotein [Oryza sativa Japonica Group] Length = 547 Score = 134 bits (337), Expect = 8e-30 Identities = 60/103 (58%), Positives = 74/103 (71%) Frame = -2 Query: 316 LPIRFWGYALETAARILNLVPTKKVSKTPYETWFGKTPSLKYLRVWGCEAYVRRETQDKL 137 LP+ FWGYALETAA LN VP+K V KTPYE W GK PSL L++WGCE YV+R DKL Sbjct: 11 LPLSFWGYALETAAFTLNRVPSKSVDKTPYEIWTGKRPSLSLLKIWGCEVYVKRLQSDKL 70 Query: 136 EPRSEKVVFIGYPTTSYGYIFYKPSENKVFVSRGAVFLERNML 8 P+S+K F+GYP + GY FY E KVFV+R +VFL++ + Sbjct: 71 TPKSDKCFFVGYPKETKGYYFYNREEGKVFVARHSVFLKKEFI 113 >gb|ABF96975.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza sativa Japonica Group] Length = 562 Score = 134 bits (337), Expect = 8e-30 Identities = 60/103 (58%), Positives = 74/103 (71%) Frame = -2 Query: 316 LPIRFWGYALETAARILNLVPTKKVSKTPYETWFGKTPSLKYLRVWGCEAYVRRETQDKL 137 LP+ FWGYALETAA LN VP+K V KTPYE W GK PSL L++WGCE YV+R DKL Sbjct: 11 LPLSFWGYALETAAFTLNRVPSKSVDKTPYEIWTGKRPSLSLLKIWGCEVYVKRLQSDKL 70 Query: 136 EPRSEKVVFIGYPTTSYGYIFYKPSENKVFVSRGAVFLERNML 8 P+S+K F+GYP + GY FY E KVFV+R +VFL++ + Sbjct: 71 TPKSDKCFFVGYPKETKGYYFYNREEGKVFVARHSVFLKKEFI 113