BLASTX nr result
ID: Atractylodes21_contig00033645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033645 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containi... 81 8e-14 ref|XP_002325952.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_003554979.1| PREDICTED: putative pentatricopeptide repeat... 65 4e-09 ref|XP_002525536.1| pentatricopeptide repeat-containing protein,... 64 1e-08 ref|XP_003637484.1| Pentatricopeptide repeat-containing protein ... 55 5e-06 >ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Vitis vinifera] Length = 582 Score = 81.3 bits (199), Expect = 8e-14 Identities = 36/67 (53%), Positives = 50/67 (74%) Frame = -3 Query: 211 DVCSLMIDNCGWLEDYDTMTTLLEKFNHEKICLNNKAFGFLPVLDSSKAHAMESIASVIG 32 D+CSL+IDNCG L DY+TM LL+ FN +++CL +KAFGF+PV SKA M+ + +I Sbjct: 269 DICSLIIDNCGRLGDYETMRCLLKDFNSKRVCLTSKAFGFVPVFTLSKASIMDFVRKLIE 328 Query: 31 ILNKVGG 11 +L+ VGG Sbjct: 329 VLDDVGG 335 >ref|XP_002325952.1| predicted protein [Populus trichocarpa] gi|222862827|gb|EEF00334.1| predicted protein [Populus trichocarpa] Length = 432 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/71 (47%), Positives = 49/71 (69%) Frame = -3 Query: 214 ADVCSLMIDNCGWLEDYDTMTTLLEKFNHEKICLNNKAFGFLPVLDSSKAHAMESIASVI 35 +D+CSL+IDNCG L+DYD M +LL +FN ++CL KAF FL V++ + +ES VI Sbjct: 124 SDICSLVIDNCGRLDDYDAMRSLLNEFNENQLCLTKKAFEFLHVMNVTNESLVESTQRVI 183 Query: 34 GILNKVGGSSH 2 +L +V GS + Sbjct: 184 VLLLEVRGSCY 194 >ref|XP_003554979.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Glycine max] Length = 390 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/67 (46%), Positives = 43/67 (64%) Frame = -3 Query: 211 DVCSLMIDNCGWLEDYDTMTTLLEKFNHEKICLNNKAFGFLPVLDSSKAHAMESIASVIG 32 D+ SL I+NCG L +Y+ M +L F+H ++ L KAFGFL L KA +ME + V+ Sbjct: 83 DIGSLFINNCGLLGNYEAMVPVLSGFSHRRVFLGMKAFGFLLDLGLDKASSMECVRKVMA 142 Query: 31 ILNKVGG 11 + NKVGG Sbjct: 143 VFNKVGG 149 >ref|XP_002525536.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535215|gb|EEF36894.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 430 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/71 (39%), Positives = 48/71 (67%) Frame = -3 Query: 214 ADVCSLMIDNCGWLEDYDTMTTLLEKFNHEKICLNNKAFGFLPVLDSSKAHAMESIASVI 35 +D+CSL+IDNCG L+DY M LL+ F+ +++ L KAF +L + S + ++ +V+ Sbjct: 123 SDICSLVIDNCGHLDDYKAMRCLLDGFSLQRLFLTKKAFEYLQLTSSKEELLKKATQNVV 182 Query: 34 GILNKVGGSSH 2 IL ++GG+S+ Sbjct: 183 DILQEIGGTSY 193 >ref|XP_003637484.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503419|gb|AES84622.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 327 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/62 (40%), Positives = 39/62 (62%) Frame = -3 Query: 196 MIDNCGWLEDYDTMTTLLEKFNHEKICLNNKAFGFLPVLDSSKAHAMESIASVIGILNKV 17 ++DNCG L D+D M +L FN +++CL +AF FL VL + M+ I ++ +L +V Sbjct: 42 VVDNCGLLRDFDAMVPILRDFNSKRVCLGRRAFRFLVVLWLDEDSRMD-IVRIVNVLKEV 100 Query: 16 GG 11 GG Sbjct: 101 GG 102