BLASTX nr result
ID: Atractylodes21_contig00033417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033417 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457142.1| hypothetical protein SORBIDRAFT_03g001900 [S... 86 2e-15 ref|XP_002316291.1| predicted protein [Populus trichocarpa] gi|2... 86 2e-15 ref|XP_002311165.1| predicted protein [Populus trichocarpa] gi|2... 86 2e-15 ref|NP_001150142.1| antigenic determinant of rec-A protein [Zea ... 86 2e-15 ref|NP_564690.1| DNA/RNA-binding protein Kin17 conserved region-... 86 3e-15 >ref|XP_002457142.1| hypothetical protein SORBIDRAFT_03g001900 [Sorghum bicolor] gi|241929117|gb|EES02262.1| hypothetical protein SORBIDRAFT_03g001900 [Sorghum bicolor] Length = 424 Score = 86.3 bits (212), Expect = 2e-15 Identities = 37/45 (82%), Positives = 45/45 (100%) Frame = +1 Query: 1 GAYRGSNARLLSVNTEKFCAKVQIEKGIYDGRVIQAIEYEDICKV 135 GAYRGSNARLLSV+TEKFCAKVQ+EKG+YDG+V++A+EYEDICK+ Sbjct: 378 GAYRGSNARLLSVDTEKFCAKVQVEKGLYDGKVLRAVEYEDICKI 422 >ref|XP_002316291.1| predicted protein [Populus trichocarpa] gi|222865331|gb|EEF02462.1| predicted protein [Populus trichocarpa] Length = 400 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 1 GAYRGSNARLLSVNTEKFCAKVQIEKGIYDGRVIQAIEYEDICKV 135 GAYRGSNARLL V+TEKFCAKVQIEKGIYDGRV++A+EYEDICK+ Sbjct: 355 GAYRGSNARLLGVDTEKFCAKVQIEKGIYDGRVLKAVEYEDICKL 399 >ref|XP_002311165.1| predicted protein [Populus trichocarpa] gi|222850985|gb|EEE88532.1| predicted protein [Populus trichocarpa] Length = 396 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 1 GAYRGSNARLLSVNTEKFCAKVQIEKGIYDGRVIQAIEYEDICKV 135 GAYRGSNARLL V+TEKFCAKVQIEKGIYDGRV++A+EYEDICK+ Sbjct: 351 GAYRGSNARLLGVDTEKFCAKVQIEKGIYDGRVLKAVEYEDICKL 395 >ref|NP_001150142.1| antigenic determinant of rec-A protein [Zea mays] gi|194707714|gb|ACF87941.1| unknown [Zea mays] gi|195637094|gb|ACG38015.1| antigenic determinant of rec-A protein [Zea mays] gi|413935581|gb|AFW70132.1| hypothetical protein ZEAMMB73_750082 [Zea mays] Length = 424 Score = 86.3 bits (212), Expect = 2e-15 Identities = 37/45 (82%), Positives = 45/45 (100%) Frame = +1 Query: 1 GAYRGSNARLLSVNTEKFCAKVQIEKGIYDGRVIQAIEYEDICKV 135 GAYRGSNARLLSV+TEKFCAKVQ+EKG+YDG+V++A+EYEDICK+ Sbjct: 378 GAYRGSNARLLSVDTEKFCAKVQVEKGLYDGKVLRAVEYEDICKI 422 >ref|NP_564690.1| DNA/RNA-binding protein Kin17 conserved region-containing protein [Arabidopsis thaliana] gi|13430440|gb|AAK25842.1|AF360132_1 unknown protein [Arabidopsis thaliana] gi|4204268|gb|AAD10649.1| Similar to Kin17 protein [Arabidopsis thaliana] gi|15293155|gb|AAK93688.1| unknown protein [Arabidopsis thaliana] gi|332195127|gb|AEE33248.1| DNA/RNA-binding protein Kin17 conserved region-containing protein [Arabidopsis thaliana] Length = 411 Score = 85.9 bits (211), Expect = 3e-15 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 1 GAYRGSNARLLSVNTEKFCAKVQIEKGIYDGRVIQAIEYEDICKV 135 GAYRGSNARLL V+TEKFCAKVQIEKG+YDGRVI++IEYEDICK+ Sbjct: 366 GAYRGSNARLLGVDTEKFCAKVQIEKGVYDGRVIKSIEYEDICKL 410