BLASTX nr result
ID: Atractylodes21_contig00033334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033334 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containi... 124 6e-27 emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera] 124 6e-27 ref|XP_002870941.1| pentatricopeptide repeat-containing protein ... 117 7e-25 ref|NP_195731.1| pentatricopeptide repeat-containing protein [Ar... 114 1e-23 ref|XP_004139059.1| PREDICTED: pentatricopeptide repeat-containi... 105 3e-21 >ref|XP_002275790.2| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Vitis vinifera] Length = 746 Score = 124 bits (312), Expect = 6e-27 Identities = 59/92 (64%), Positives = 77/92 (83%) Frame = +2 Query: 5 QLGQKFLDTIATNHPKFKHSSLTLSAAVHLLSRNKKYSDAQALLLRMIRKSGVSRGVIVD 184 QLGQ+F+D+I +N P FKHS + SA +H+L R+++ DAQA++LRM+RKSGVSR IV+ Sbjct: 112 QLGQRFIDSITSNCPNFKHSLQSFSAMIHILVRSRRLPDAQAVILRMVRKSGVSRVEIVE 171 Query: 185 SLVSTYEKCGSSPVVFDLLIRTYVQARKIREG 280 SLV TY CGS+P+VFDLL+RTYVQARK+REG Sbjct: 172 SLVLTYGNCGSNPLVFDLLVRTYVQARKLREG 203 >emb|CAN63985.1| hypothetical protein VITISV_001389 [Vitis vinifera] Length = 850 Score = 124 bits (312), Expect = 6e-27 Identities = 59/92 (64%), Positives = 77/92 (83%) Frame = +2 Query: 5 QLGQKFLDTIATNHPKFKHSSLTLSAAVHLLSRNKKYSDAQALLLRMIRKSGVSRGVIVD 184 QLGQ+F+D+I +N P FKHS + SA +H+L R+++ DAQA++LRM+RKSGVSR IV+ Sbjct: 216 QLGQRFIDSITSNCPNFKHSLQSFSAMIHILVRSRRLPDAQAVILRMVRKSGVSRVEIVE 275 Query: 185 SLVSTYEKCGSSPVVFDLLIRTYVQARKIREG 280 SLV TY CGS+P+VFDLL+RTYVQARK+REG Sbjct: 276 SLVLTYGNCGSNPLVFDLLVRTYVQARKLREG 307 >ref|XP_002870941.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316778|gb|EFH47200.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 719 Score = 117 bits (294), Expect = 7e-25 Identities = 58/90 (64%), Positives = 74/90 (82%) Frame = +2 Query: 8 LGQKFLDTIATNHPKFKHSSLTLSAAVHLLSRNKKYSDAQALLLRMIRKSGVSRGVIVDS 187 LGQ+F+D + N P FKH+SL+LSA +H+L R+ + SDAQ+ +LRMIR+SGVSR IV+S Sbjct: 84 LGQRFVDQLGFNFPNFKHTSLSLSAMIHILVRSGRLSDAQSCVLRMIRRSGVSRVEIVNS 143 Query: 188 LVSTYEKCGSSPVVFDLLIRTYVQARKIRE 277 LVSTY CGS+ VFDLLIRT+VQARK+RE Sbjct: 144 LVSTYSNCGSNDSVFDLLIRTFVQARKLRE 173 >ref|NP_195731.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174092|sp|Q9LFC5.1|PP360_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g01110 gi|6759434|emb|CAB69839.1| putative protein [Arabidopsis thaliana] gi|28973740|gb|AAO64186.1| unknown protein [Arabidopsis thaliana] gi|110736884|dbj|BAF00399.1| hypothetical protein [Arabidopsis thaliana] gi|332002917|gb|AED90300.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 729 Score = 114 bits (284), Expect = 1e-23 Identities = 57/90 (63%), Positives = 73/90 (81%) Frame = +2 Query: 8 LGQKFLDTIATNHPKFKHSSLTLSAAVHLLSRNKKYSDAQALLLRMIRKSGVSRGVIVDS 187 LGQ+F+D + + P FKH+SL+LSA +H+L R+ + SDAQ+ LLRMIR+SGVSR IV+S Sbjct: 94 LGQRFVDQLGFHFPNFKHTSLSLSAMIHILVRSGRLSDAQSCLLRMIRRSGVSRLEIVNS 153 Query: 188 LVSTYEKCGSSPVVFDLLIRTYVQARKIRE 277 L ST+ CGS+ VFDLLIRTYVQARK+RE Sbjct: 154 LDSTFSNCGSNDSVFDLLIRTYVQARKLRE 183 >ref|XP_004139059.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110-like [Cucumis sativus] Length = 749 Score = 105 bits (263), Expect = 3e-21 Identities = 52/91 (57%), Positives = 71/91 (78%) Frame = +2 Query: 8 LGQKFLDTIATNHPKFKHSSLTLSAAVHLLSRNKKYSDAQALLLRMIRKSGVSRGVIVDS 187 LG KF+ ++ + P FKHSSL+LSA VH L R ++ S+AQA +LRM+RKSGVSR +V+S Sbjct: 116 LGLKFIGLVSYHFPNFKHSSLSLSAMVHFLVRGRRLSEAQACILRMVRKSGVSRVKVVES 175 Query: 188 LVSTYEKCGSSPVVFDLLIRTYVQARKIREG 280 L+ST GS +++DLL+RTYVQA+K+REG Sbjct: 176 LISTCFYFGSVGLIYDLLVRTYVQAKKLREG 206