BLASTX nr result
ID: Atractylodes21_contig00033186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00033186 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031709.1| protein kinase family protein [Arabidopsis t... 69 5e-10 ref|XP_002867643.1| ATP binding protein [Arabidopsis lyrata subs... 69 5e-10 emb|CAB41121.1| putative protein [Arabidopsis thaliana] gi|72693... 69 5e-10 ref|XP_002318112.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_002862346.1| ATP binding protein [Arabidopsis lyrata subs... 65 4e-09 >ref|NP_001031709.1| protein kinase family protein [Arabidopsis thaliana] gi|332659564|gb|AEE84964.1| protein kinase family protein [Arabidopsis thaliana] Length = 481 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 139 LDFKEIQENFSAGFRPWQRSFQFWVRAVDIYTGYK 243 +DFKEIQE S GFRPWQRSFQFW RA DIYTGYK Sbjct: 4 IDFKEIQEKLSDGFRPWQRSFQFWARATDIYTGYK 38 >ref|XP_002867643.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297313479|gb|EFH43902.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] Length = 481 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 139 LDFKEIQENFSAGFRPWQRSFQFWVRAVDIYTGYK 243 +DFKEIQE S GFRPWQRSFQFW RA DIYTGYK Sbjct: 4 IDFKEIQEKLSDGFRPWQRSFQFWARATDIYTGYK 38 >emb|CAB41121.1| putative protein [Arabidopsis thaliana] gi|7269332|emb|CAB79391.1| putative protein [Arabidopsis thaliana] Length = 410 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 139 LDFKEIQENFSAGFRPWQRSFQFWVRAVDIYTGYK 243 +DFKEIQE S GFRPWQRSFQFW RA DIYTGYK Sbjct: 4 IDFKEIQEKLSDGFRPWQRSFQFWARATDIYTGYK 38 >ref|XP_002318112.1| predicted protein [Populus trichocarpa] gi|222858785|gb|EEE96332.1| predicted protein [Populus trichocarpa] Length = 471 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 139 LDFKEIQENFSAGFRPWQRSFQFWVRAVDIYTGYK 243 LDFK+IQE S FRPWQRSFQFWVRA DIYTGYK Sbjct: 5 LDFKDIQEKLSTQFRPWQRSFQFWVRAADIYTGYK 39 >ref|XP_002862346.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297307766|gb|EFH38604.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata] Length = 479 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 142 DFKEIQENFSAGFRPWQRSFQFWVRAVDIYTGYK 243 DFKEIQE S FRPWQRSFQFWVRA +IYTGYK Sbjct: 5 DFKEIQEKISESFRPWQRSFQFWVRATNIYTGYK 38