BLASTX nr result
ID: Atractylodes21_contig00032978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032978 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330829.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 gb|ABK95909.1| unknown [Populus trichocarpa] 71 1e-10 ref|XP_002332120.1| predicted protein [Populus trichocarpa] gi|1... 69 4e-10 ref|XP_002527994.1| Protein AIG2, putative [Ricinus communis] gi... 67 1e-09 ref|XP_004160835.1| PREDICTED: AIG2-like protein-like [Cucumis s... 67 2e-09 >ref|XP_002330829.1| predicted protein [Populus trichocarpa] gi|222872631|gb|EEF09762.1| predicted protein [Populus trichocarpa] Length = 173 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 228 FVYGSLLADDVVRVLLHRLPQTSPSILHGYHRFSIKGRV 344 FVYGSLLADDVVR LL R+PQ+SP+IL+GYHRFSIKGRV Sbjct: 14 FVYGSLLADDVVRALLSRIPQSSPAILNGYHRFSIKGRV 52 >gb|ABK95909.1| unknown [Populus trichocarpa] Length = 109 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 228 FVYGSLLADDVVRVLLHRLPQTSPSILHGYHRFSIKGRV 344 FVYGSLLADDVVR LL R+PQ+SP+IL+GYHRFSIKGRV Sbjct: 16 FVYGSLLADDVVRALLSRIPQSSPAILNGYHRFSIKGRV 54 >ref|XP_002332120.1| predicted protein [Populus trichocarpa] gi|118486737|gb|ABK95204.1| unknown [Populus trichocarpa] gi|222874940|gb|EEF12071.1| predicted protein [Populus trichocarpa] Length = 173 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 228 FVYGSLLADDVVRVLLHRLPQTSPSILHGYHRFSIKGRV 344 FVYGSLLADDVVR LL R+PQ+SP+IL+G+HRFSIKGRV Sbjct: 13 FVYGSLLADDVVRALLSRIPQSSPAILNGHHRFSIKGRV 51 >ref|XP_002527994.1| Protein AIG2, putative [Ricinus communis] gi|223532620|gb|EEF34406.1| Protein AIG2, putative [Ricinus communis] Length = 178 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +3 Query: 228 FVYGSLLADDVVRVLLHRLPQTSPSILHGYHRFSIKGRV 344 FVYGSLL +D+VRVLL R+P++SP++LHG+HRFSIKGRV Sbjct: 11 FVYGSLLEEDIVRVLLKRVPRSSPAVLHGFHRFSIKGRV 49 >ref|XP_004160835.1| PREDICTED: AIG2-like protein-like [Cucumis sativus] Length = 188 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 228 FVYGSLLADDVVRVLLHRLPQTSPSILHGYHRFSIKGRV 344 FVYGSLLADD+VRVLL R+PQ+S ++LHGY RFS++GRV Sbjct: 27 FVYGSLLADDIVRVLLKRIPQSSSAVLHGYQRFSVRGRV 65