BLASTX nr result
ID: Atractylodes21_contig00032895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032895 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus ... 61 8e-08 ref|XP_003588816.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 55 5e-06 >ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551031|gb|EEF52517.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 426 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/73 (46%), Positives = 47/73 (64%) Frame = -1 Query: 226 EIDQIILYLSMSNTLKRFSFMYMLDNRYKLPTSLFSFQPLETLKLAFCAFEPPLTFNGLS 47 +ID+ IL+LS S+ +K F RYK+P+SLFSF+ L L+L C +PPLTF G Sbjct: 109 DIDRWILHLSRSS-IKEFILEIWKGQRYKVPSSLFSFEHLIHLELFNCLLQPPLTFKGFR 167 Query: 46 MLKSLYLLYVEIT 8 LKSL L ++ +T Sbjct: 168 SLKSLDLQHITLT 180 >ref|XP_003588816.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355477864|gb|AES59067.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 382 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/73 (43%), Positives = 40/73 (54%) Frame = -1 Query: 226 EIDQIILYLSMSNTLKRFSFMYMLDNRYKLPTSLFSFQPLETLKLAFCAFEPPLTFNGLS 47 +IDQ I +S +K F L RYK+P LFS Q L+ L+L +C PP TF G Sbjct: 139 DIDQWIFQIS-KRYIKEFVLDIRLKPRYKIPCCLFSCQSLQHLELNYCCLNPPTTFEGFR 197 Query: 46 MLKSLYLLYVEIT 8 LKSL L V +T Sbjct: 198 NLKSLSLFEVTMT 210