BLASTX nr result
ID: Atractylodes21_contig00032872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032872 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521240.1| WD-repeat protein, putative [Ricinus communi... 55 6e-06 >ref|XP_002521240.1| WD-repeat protein, putative [Ricinus communis] gi|223539508|gb|EEF41096.1| WD-repeat protein, putative [Ricinus communis] Length = 482 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 7/63 (11%) Frame = -2 Query: 298 LPTNIEKLRPR-NSWM---DSPRDIMLQLLSM---RTSPDSERQDADVGRNVLNFILTFN 140 LPTNI +L+P+ WM SP+D+MLQL S+ RTSP+ + + GR +L +LTFN Sbjct: 404 LPTNIGRLKPKARGWMYRIASPQDLMLQLFSLQRWRTSPERIEESSAAGRELLELMLTFN 463 Query: 139 ANS 131 ANS Sbjct: 464 ANS 466