BLASTX nr result
ID: Atractylodes21_contig00032702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032702 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG68298.1| serine palmitoyltransferase [Nicotiana benthamiana] 104 7e-21 ref|XP_004161364.1| PREDICTED: LOW QUALITY PROTEIN: long chain b... 101 6e-20 ref|XP_004138028.1| PREDICTED: long chain base biosynthesis prot... 101 6e-20 ref|XP_003634228.1| PREDICTED: serine palmitoyltransferase 2 iso... 101 6e-20 ref|XP_002284409.1| PREDICTED: serine palmitoyltransferase 2 iso... 101 6e-20 >dbj|BAG68298.1| serine palmitoyltransferase [Nicotiana benthamiana] Length = 489 Score = 104 bits (260), Expect = 7e-21 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +3 Query: 54 MITIPYLTALTTYFSYGLLFAFGQLRDFFRNLVDWWKASNLQGYAPICLGL 206 MITIPYLTALTTYFSYGLLFAFGQ RDFFR + DWWKASNLQGYAPICLGL Sbjct: 1 MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGL 51 >ref|XP_004161364.1| PREDICTED: LOW QUALITY PROTEIN: long chain base biosynthesis protein 2a-like [Cucumis sativus] Length = 490 Score = 101 bits (252), Expect = 6e-20 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +3 Query: 54 MITIPYLTALTTYFSYGLLFAFGQLRDFFRNLVDWWKASNLQGYAPICLGL 206 MITIPYLTALTTYFSYGLLFAFGQ RDFFR + DWW +SNLQGYAPICLGL Sbjct: 1 MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGL 51 >ref|XP_004138028.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cucumis sativus] Length = 490 Score = 101 bits (252), Expect = 6e-20 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +3 Query: 54 MITIPYLTALTTYFSYGLLFAFGQLRDFFRNLVDWWKASNLQGYAPICLGL 206 MITIPYLTALTTYFSYGLLFAFGQ RDFFR + DWW +SNLQGYAPICLGL Sbjct: 1 MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGL 51 >ref|XP_003634228.1| PREDICTED: serine palmitoyltransferase 2 isoform 2 [Vitis vinifera] gi|297734488|emb|CBI15735.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 101 bits (252), Expect = 6e-20 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +3 Query: 54 MITIPYLTALTTYFSYGLLFAFGQLRDFFRNLVDWWKASNLQGYAPICLGL 206 MITIPYLTALTT FSYGLLFAFGQ RDFFR + DWWKASNLQGYAPICLGL Sbjct: 1 MITIPYLTALTTLFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGL 51 >ref|XP_002284409.1| PREDICTED: serine palmitoyltransferase 2 isoform 1 [Vitis vinifera] Length = 489 Score = 101 bits (252), Expect = 6e-20 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +3 Query: 54 MITIPYLTALTTYFSYGLLFAFGQLRDFFRNLVDWWKASNLQGYAPICLGL 206 MITIPYLTALTT FSYGLLFAFGQ RDFFR + DWWKASNLQGYAPICLGL Sbjct: 1 MITIPYLTALTTLFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGL 51