BLASTX nr result
ID: Atractylodes21_contig00032437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032437 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540759.1| PREDICTED: putative cyclic nucleotide-gated ... 65 8e-09 ref|NP_180393.1| cyclic nucleotide-gated channel 15 [Arabidopsis... 62 4e-08 ref|XP_003606366.1| CNGC5-like protein [Medicago truncatula] gi|... 62 4e-08 ref|XP_002880939.1| ATCNGC15 [Arabidopsis lyrata subsp. lyrata] ... 62 4e-08 ref|XP_003590482.1| CNGC5-like protein [Medicago truncatula] gi|... 62 4e-08 >ref|XP_003540759.1| PREDICTED: putative cyclic nucleotide-gated ion channel 15-like [Glycine max] Length = 692 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 211 VKSYICAELVRRIPLFDQMDERTVDAICERLKPMICIPRT 92 +K ++C ELVRR+PLFDQMDER +DAICERLKP +C T Sbjct: 463 IKRHLCLELVRRVPLFDQMDERMLDAICERLKPALCTENT 502 >ref|NP_180393.1| cyclic nucleotide-gated channel 15 [Arabidopsis thaliana] gi|38503241|sp|Q9SL29.1|CNG15_ARATH RecName: Full=Putative cyclic nucleotide-gated ion channel 15; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 15 gi|4803955|gb|AAD29827.1| putative cyclic nucleotide and calmodulin-regulated ion channel protein [Arabidopsis thaliana] gi|330253003|gb|AEC08097.1| cyclic nucleotide-gated channel 15 [Arabidopsis thaliana] Length = 678 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 211 VKSYICAELVRRIPLFDQMDERTVDAICERLKPMICIPRT 92 +K ++C +LVRR+PLFDQMDER +DAICERLKP +C T Sbjct: 457 IKRHLCFDLVRRVPLFDQMDERMLDAICERLKPALCTEGT 496 >ref|XP_003606366.1| CNGC5-like protein [Medicago truncatula] gi|355507421|gb|AES88563.1| CNGC5-like protein [Medicago truncatula] Length = 685 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 211 VKSYICAELVRRIPLFDQMDERTVDAICERLKPMICIPRT 92 +K ++C ELVRR+PLFD MDER +DAICERLKP +C T Sbjct: 448 IKRHLCLELVRRVPLFDAMDERMLDAICERLKPALCTENT 487 >ref|XP_002880939.1| ATCNGC15 [Arabidopsis lyrata subsp. lyrata] gi|297326778|gb|EFH57198.1| ATCNGC15 [Arabidopsis lyrata subsp. lyrata] Length = 678 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 211 VKSYICAELVRRIPLFDQMDERTVDAICERLKPMICIPRT 92 +K ++C +LVRR+PLFDQMDER +DAICERLKP +C T Sbjct: 457 IKRHLCFDLVRRVPLFDQMDERMLDAICERLKPALCTEGT 496 >ref|XP_003590482.1| CNGC5-like protein [Medicago truncatula] gi|355479530|gb|AES60733.1| CNGC5-like protein [Medicago truncatula] Length = 710 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 211 VKSYICAELVRRIPLFDQMDERTVDAICERLKPMICIPRT 92 +K ++C LVR++PLFDQMD+R +DAICERLKP +C P T Sbjct: 460 IKRHLCLNLVRQVPLFDQMDDRMLDAICERLKPTLCTPGT 499