BLASTX nr result
ID: Atractylodes21_contig00032432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032432 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634707.1| PREDICTED: DDRGK domain-containing protein 1... 67 2e-09 ref|XP_002522860.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_003634707.1| PREDICTED: DDRGK domain-containing protein 1-like [Vitis vinifera] gi|297735965|emb|CBI23939.3| unnamed protein product [Vitis vinifera] Length = 297 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -3 Query: 131 MEDMFVAILSMLLVVALIPLYLWRRRQVVQSHDEQEEEAQVQQ 3 MED+FV ILSMLLV+ALIPLYLW+RRQ +S DE EEE QVQQ Sbjct: 1 MEDLFVFILSMLLVIALIPLYLWKRRQDSRSSDEHEEEHQVQQ 43 >ref|XP_002522860.1| conserved hypothetical protein [Ricinus communis] gi|223537944|gb|EEF39558.1| conserved hypothetical protein [Ricinus communis] Length = 300 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -3 Query: 131 MEDMFVAILSMLLVVALIPLYLWRRRQVVQSHDEQEEEAQVQQ 3 ME++FVAI+SMLL+++LIPLY+W+RRQ +S D +E+ QV Q Sbjct: 1 MEELFVAIISMLLIISLIPLYIWKRRQDSRSADLHQEDPQVPQ 43