BLASTX nr result
ID: Atractylodes21_contig00032252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032252 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535248.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 >ref|XP_002535248.1| conserved hypothetical protein [Ricinus communis] gi|223523658|gb|EEF27135.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 118 SIFCRLSACSADLRGFQSPGTACLFSAAITVSFP 219 SIFCRLSACSADLRGFQSPGTACLFSAAITV FP Sbjct: 33 SIFCRLSACSADLRGFQSPGTACLFSAAITVCFP 66 Score = 60.8 bits (146), Expect = 1e-07 Identities = 36/49 (73%), Positives = 38/49 (77%), Gaps = 4/49 (8%) Frame = +2 Query: 14 MMMEMYCGLLLFINSNRILLQLMLRISLTLQA--IC--SASSADCQPVQ 148 M+MEMYCGL LFINSN ILLQLMLRISLTLQA C SA SAD + Q Sbjct: 1 MVMEMYCGLFLFINSNLILLQLMLRISLTLQASIFCRLSACSADLRGFQ 49