BLASTX nr result
ID: Atractylodes21_contig00032181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00032181 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593218.1| Methyl binding domain protein [Medicago trun... 55 8e-06 emb|CBI34055.3| unnamed protein product [Vitis vinifera] 55 8e-06 emb|CAN64936.1| hypothetical protein VITISV_021553 [Vitis vinifera] 55 8e-06 >ref|XP_003593218.1| Methyl binding domain protein [Medicago truncatula] gi|355482266|gb|AES63469.1| Methyl binding domain protein [Medicago truncatula] Length = 805 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = +3 Query: 3 EADEIVKVLPRNWKIELALRHRAGLPSIYCRSYVSSSGLQFKSCKDVARYLR 158 +A + VLP WK+ L+L+ + G IYCR Y+S +G QF SCK+V+ YL+ Sbjct: 213 DASDFGDVLPLGWKLLLSLKRKDGRAWIYCRRYISPNGQQFLSCKEVSSYLQ 264 >emb|CBI34055.3| unnamed protein product [Vitis vinifera] Length = 590 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +3 Query: 27 LPRNWKIELALRHRAGLPSIYCRSYVSSSGLQFKSCKDVARYLR 158 LP WK+ L L+ R G S+YCR Y+S SG QF SCK+ A YL+ Sbjct: 106 LPIGWKLLLGLKRREGRVSVYCRRYISPSGEQFVSCKEAAAYLQ 149 >emb|CAN64936.1| hypothetical protein VITISV_021553 [Vitis vinifera] Length = 849 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = +3 Query: 27 LPRNWKIELALRHRAGLPSIYCRSYVSSSGLQFKSCKDVARYLR 158 LP WK+ L L+ R G S+YCR Y+S SG QF SCK+ A YL+ Sbjct: 252 LPIGWKLLLGLKRREGRVSVYCRRYISPSGEQFVSCKEAAAYLQ 295