BLASTX nr result
ID: Atractylodes21_contig00031770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031770 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633051.1| PREDICTED: uncharacterized protein LOC100854... 62 4e-08 ref|XP_002526975.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_003633051.1| PREDICTED: uncharacterized protein LOC100854333 [Vitis vinifera] Length = 1689 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +2 Query: 2 KDLLHFLGTHASHMQLHVLYQPGLSDEMRAFKIGNVASRTIVEQLLQDFCTT*KK 166 K+LLHF ++AS + L VL+QPGL DEMRAF++ V SR +EQLL +F T K+ Sbjct: 1635 KNLLHFFNSNASQLPLKVLHQPGLRDEMRAFEVDQVTSRRTIEQLLDEFGGTSKR 1689 >ref|XP_002526975.1| conserved hypothetical protein [Ricinus communis] gi|223533666|gb|EEF35402.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 2 KDLLHFLGTHASHMQLHVLYQPGLSDEMRAFKIGNVASRTIVEQLLQDF 148 K+LL FL ++A H+ L VL+QPGL DEMR F+I + SR +E+LL++F Sbjct: 522 KNLLLFLNSNALHLPLKVLHQPGLKDEMRVFEIDKITSRKTIERLLEEF 570