BLASTX nr result
ID: Atractylodes21_contig00031734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031734 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_647034.1| hypothetical protein MW2217 [Staphylococcus aur... 54 1e-05 gb|AFH57717.1| ScaC, partial [Staphylococcus aureus] 54 1e-05 gb|AFH57714.1| ScaC, partial [Staphylococcus aureus] 54 1e-05 ref|ZP_12925772.1| secretory antigen SsaA [Staphylococcus aureus... 54 1e-05 ref|ZP_12539531.1| secretory antigen SsaA [Staphylococcus aureus... 54 1e-05 >ref|NP_647034.1| hypothetical protein MW2217 [Staphylococcus aureus subsp. aureus MW2] gi|49487080|ref|YP_044301.1| hypothetical protein SAS2189 [Staphylococcus aureus subsp. aureus MSSA476] gi|253734292|ref|ZP_04868457.1| secretory antigen [Staphylococcus aureus subsp. aureus TCH130] gi|258422743|ref|ZP_05685648.1| staphyloxanthin biosynthesis protein [Staphylococcus aureus A9635] gi|300910900|ref|ZP_07128350.1| secretory antigen [Staphylococcus aureus subsp. aureus TCH70] gi|379021961|ref|YP_005298623.1| Secretory antigen precursor SsaA [Staphylococcus aureus subsp. aureus M013] gi|385782532|ref|YP_005758703.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus 11819-97] gi|386831869|ref|YP_006238523.1| hypothetical protein SAEMRSA15_21960 [Staphylococcus aureus subsp. aureus HO 5096 0412] gi|417795903|ref|ZP_12443120.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21305] gi|417800524|ref|ZP_12447643.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21310] gi|417890882|ref|ZP_12534950.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21200] gi|417900866|ref|ZP_12544744.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21266] gi|418282002|ref|ZP_12894794.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21202] gi|418306536|ref|ZP_12918322.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21194] gi|418320135|ref|ZP_12931498.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus VCU006] gi|418573201|ref|ZP_13137401.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21333] gi|418599162|ref|ZP_13162654.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21343] gi|418657456|ref|ZP_13219223.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus IS-105] gi|418876155|ref|ZP_13430402.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIGC93] gi|418887533|ref|ZP_13441672.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIG1524] gi|418932602|ref|ZP_13486428.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIGC128] gi|418952463|ref|ZP_13504490.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus IS-160] gi|418989329|ref|ZP_13536996.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIG1835] gi|448741006|ref|ZP_21722979.1| ScaC [Staphylococcus aureus KT/314250] gi|448743875|ref|ZP_21725781.1| ScaC [Staphylococcus aureus KT/Y21] gi|458624183|ref|ZP_22724008.1| hypothetical protein SAPM1_RS08695 [Staphylococcus aureus PM1] gi|459188547|ref|ZP_23260517.1| hypothetical protein OOI_RS06085 [Staphylococcus aureus subsp. aureus 118] gi|81648790|sp|Q6G723.1|SSAA2_STAAS RecName: Full=Staphylococcal secretory antigen ssaA2; Flags: Precursor gi|81762108|sp|Q8NV83.1|SSAA2_STAAW RecName: Full=Staphylococcal secretory antigen ssaA2; Flags: Precursor gi|21205388|dbj|BAB96082.1| MW2217 [Staphylococcus aureus subsp. aureus MW2] gi|49245523|emb|CAG44000.1| putative exported protein [Staphylococcus aureus subsp. aureus MSSA476] gi|253727708|gb|EES96437.1| secretory antigen [Staphylococcus aureus subsp. aureus TCH130] gi|257847154|gb|EEV71163.1| staphyloxanthin biosynthesis protein [Staphylococcus aureus A9635] gi|300887880|gb|EFK83075.1| secretory antigen [Staphylococcus aureus subsp. aureus TCH70] gi|334270316|gb|EGL88721.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21305] gi|334271070|gb|EGL89465.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21310] gi|341846635|gb|EGS87826.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21266] gi|341853760|gb|EGS94640.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21200] gi|359831270|gb|AEV79248.1| Secretory antigen precursor SsaA [Staphylococcus aureus subsp. aureus M013] gi|364523521|gb|AEW66271.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus 11819-97] gi|365171762|gb|EHM62532.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21202] gi|365227839|gb|EHM69026.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus VCU006] gi|365246542|gb|EHM87085.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21194] gi|371983288|gb|EHP00435.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21333] gi|374397761|gb|EHQ68965.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21343] gi|375030620|gb|EHS23930.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus IS-105] gi|375368684|gb|EHS72593.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus IS-160] gi|377715616|gb|EHT39805.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIG1835] gi|377756146|gb|EHT80043.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIG1524] gi|377767547|gb|EHT91341.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIGC93] gi|377772776|gb|EHT96522.1| secretory antigen ssaA2 [Staphylococcus aureus subsp. aureus CIGC128] gi|385197261|emb|CCG16907.1| putative exported protein [Staphylococcus aureus subsp. aureus HO 5096 0412] gi|445548236|gb|ELY16489.1| ScaC [Staphylococcus aureus KT/314250] gi|445562786|gb|ELY18951.1| ScaC [Staphylococcus aureus KT/Y21] Length = 269 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 75 NRHFN---NFYHSDVNLRTGFYRKPYFNNWSGSNYNAYNHGFKRNNFVRHHNYASD*FDN 245 N H+ N++ S +N G+Y Y+N ++ NYN YN+G+ NN+ R++NY+++ + Sbjct: 54 NYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNYNNYNNGYSYNNYSRYNNYSNN--NQ 111 Query: 246 AYGYHSY 266 +Y Y++Y Sbjct: 112 SYNYNNY 118 >gb|AFH57717.1| ScaC, partial [Staphylococcus aureus] Length = 246 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 75 NRHFN---NFYHSDVNLRTGFYRKPYFNNWSGSNYNAYNHGFKRNNFVRHHNYASD*FDN 245 N H+ N++ S +N G+Y Y+N ++ NYN YN+G+ NN+ R++NY+++ + Sbjct: 27 NYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNYNNYNNGYSYNNYSRYNNYSNN--NQ 84 Query: 246 AYGYHSY 266 +Y Y++Y Sbjct: 85 SYNYNNY 91 >gb|AFH57714.1| ScaC, partial [Staphylococcus aureus] Length = 246 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 75 NRHFN---NFYHSDVNLRTGFYRKPYFNNWSGSNYNAYNHGFKRNNFVRHHNYASD*FDN 245 N H+ N++ S +N G+Y Y+N ++ NYN YN+G+ NN+ R++NY+++ + Sbjct: 27 NYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNYNNYNNGYSYNNYSRYNNYSNN--NQ 84 Query: 246 AYGYHSY 266 +Y Y++Y Sbjct: 85 SYNYNNY 91 >ref|ZP_12925772.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21334] gi|365233920|gb|EHM74862.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21334] Length = 272 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 75 NRHFN---NFYHSDVNLRTGFYRKPYFNNWSGSNYNAYNHGFKRNNFVRHHNYASD*FDN 245 N H+ N++ S +N G+Y Y+N ++ NYN YN+G+ NN+ R++NY+++ + Sbjct: 54 NYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNYNNYNNGYSYNNYSRYNNYSNN--NQ 111 Query: 246 AYGYHSY 266 +Y Y++Y Sbjct: 112 SYNYNNY 118 >ref|ZP_12539531.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21235] gi|341841673|gb|EGS83126.1| secretory antigen SsaA [Staphylococcus aureus subsp. aureus 21235] Length = 269 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 75 NRHFN---NFYHSDVNLRTGFYRKPYFNNWSGSNYNAYNHGFKRNNFVRHHNYASD*FDN 245 N H+ N++ S +N G+Y Y+N ++ NYN YN+G+ NN+ R++NY+++ + Sbjct: 54 NYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNYNNYNNGYSYNNYSRYNNYSNN--NQ 111 Query: 246 AYGYHSY 266 +Y Y++Y Sbjct: 112 SYNYNNY 118