BLASTX nr result
ID: Atractylodes21_contig00031726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031726 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE43837.1| tobamovirus multiplication 3 [Nicotiana tabacum] 64 1e-08 ref|NP_001234096.1| tobamovirus multiplication 1 homolog [Solanu... 64 1e-08 gb|AFK42820.1| unknown [Lotus japonicus] 64 1e-08 ref|XP_002875118.1| hypothetical protein ARALYDRAFT_484143 [Arab... 64 1e-08 ref|XP_002518806.1| virion binding protein, putative [Ricinus co... 64 1e-08 >dbj|BAE43837.1| tobamovirus multiplication 3 [Nicotiana tabacum] Length = 294 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 2 YYLLVEILPSSLVLFILRKLPPKRGIIQYHAIR 100 YYLLVEILPSSLVLFILRKLPPKRGI QYH IR Sbjct: 262 YYLLVEILPSSLVLFILRKLPPKRGITQYHPIR 294 >ref|NP_001234096.1| tobamovirus multiplication 1 homolog [Solanum lycopersicum] gi|74038609|dbj|BAE43838.1| tobamovirus multiplication 1 homolog [Solanum lycopersicum] Length = 295 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 2 YYLLVEILPSSLVLFILRKLPPKRGIIQYHAIR 100 YYLLVEILPSSLVLFILRKLPPKRGI QYH IR Sbjct: 263 YYLLVEILPSSLVLFILRKLPPKRGITQYHPIR 295 >gb|AFK42820.1| unknown [Lotus japonicus] Length = 297 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 2 YYLLVEILPSSLVLFILRKLPPKRGIIQYHAIR 100 YYLLVEILPSSLVLFILRKLPPKRGI QYH IR Sbjct: 265 YYLLVEILPSSLVLFILRKLPPKRGITQYHPIR 297 >ref|XP_002875118.1| hypothetical protein ARALYDRAFT_484143 [Arabidopsis lyrata subsp. lyrata] gi|297320956|gb|EFH51377.1| hypothetical protein ARALYDRAFT_484143 [Arabidopsis lyrata subsp. lyrata] Length = 308 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 2 YYLLVEILPSSLVLFILRKLPPKRGIIQYHAIR 100 YYLLVEILPSSLVLFILRKLPPKRGI QYH IR Sbjct: 276 YYLLVEILPSSLVLFILRKLPPKRGITQYHQIR 308 >ref|XP_002518806.1| virion binding protein, putative [Ricinus communis] gi|223542187|gb|EEF43731.1| virion binding protein, putative [Ricinus communis] Length = 292 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 2 YYLLVEILPSSLVLFILRKLPPKRGIIQYHAIR 100 YYLLVEILPSSLVLFILRKLPPKRGI QYH IR Sbjct: 260 YYLLVEILPSSLVLFILRKLPPKRGITQYHPIR 292