BLASTX nr result
ID: Atractylodes21_contig00031697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031697 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511641.1| structural molecule, putative [Ricinus commu... 60 1e-07 ref|XP_001784533.1| predicted protein [Physcomitrella patens sub... 59 5e-07 gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japo... 58 7e-07 gb|EEC77764.1| hypothetical protein OsI_16907 [Oryza sativa Indi... 58 7e-07 ref|NP_001053499.1| Os04g0551700 [Oryza sativa Japonica Group] g... 58 7e-07 >ref|XP_002511641.1| structural molecule, putative [Ricinus communis] gi|223548821|gb|EEF50310.1| structural molecule, putative [Ricinus communis] Length = 217 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 367 DSVYLDDNIRVAKDIRGDYLVVDRAPYQWKE 275 +SVY+DD+IRVAKDIRGDYLVVDRAPY W+E Sbjct: 187 ESVYVDDDIRVAKDIRGDYLVVDRAPYAWRE 217 >ref|XP_001784533.1| predicted protein [Physcomitrella patens subsp. patens] gi|162663914|gb|EDQ50654.1| predicted protein [Physcomitrella patens subsp. patens] Length = 218 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 367 DSVYLDDNIRVAKDIRGDYLVVDRAPYQW 281 +S+YLDD+IRVAKDIRGDYLVVDRAPY W Sbjct: 186 ESIYLDDDIRVAKDIRGDYLVVDRAPYTW 214 >gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japonica Group] Length = 228 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 367 DSVYLDDNIRVAKDIRGDYLVVDRAPYQW 281 D+VYLDD+IRVAKDIRGDYLVV+RAPY W Sbjct: 198 DTVYLDDDIRVAKDIRGDYLVVERAPYSW 226 >gb|EEC77764.1| hypothetical protein OsI_16907 [Oryza sativa Indica Group] Length = 228 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 367 DSVYLDDNIRVAKDIRGDYLVVDRAPYQW 281 D+VYLDD+IRVAKDIRGDYLVV+RAPY W Sbjct: 198 DTVYLDDDIRVAKDIRGDYLVVERAPYSW 226 >ref|NP_001053499.1| Os04g0551700 [Oryza sativa Japonica Group] gi|113565070|dbj|BAF15413.1| Os04g0551700, partial [Oryza sativa Japonica Group] Length = 215 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 367 DSVYLDDNIRVAKDIRGDYLVVDRAPYQW 281 D+VYLDD+IRVAKDIRGDYLVV+RAPY W Sbjct: 185 DTVYLDDDIRVAKDIRGDYLVVERAPYSW 213