BLASTX nr result
ID: Atractylodes21_contig00031645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031645 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE41105.1| AP2 domain class transcription factor [Malus x do... 76 6e-18 ref|XP_004143690.1| PREDICTED: ethylene-responsive transcription... 76 8e-18 ref|XP_002312046.1| AP2 domain-containing transcription factor [... 76 2e-17 ref|XP_002275627.1| PREDICTED: ethylene-responsive transcription... 76 2e-17 ref|NP_001234647.1| AP2 transcription factor SlAP2d [Solanum lyc... 76 2e-17 >gb|ADE41105.1| AP2 domain class transcription factor [Malus x domestica] Length = 466 Score = 75.9 bits (185), Expect(2) = 6e-18 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +2 Query: 2 RGPTSRSSQYCGVTFYRRTDRWESHIWDCGKQVYLG 109 RGP SRSSQY GVTFYRRT RWESHIWDCGKQVYLG Sbjct: 148 RGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLG 183 Score = 39.7 bits (91), Expect(2) = 6e-18 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = +3 Query: 132 YIVGTYDWAAITF*GIDAGISFHINEYEEDM 224 Y YD AAI F GIDA I+F++ +YEEDM Sbjct: 190 YAARAYDRAAIKFRGIDADINFNVGDYEEDM 220 >ref|XP_004143690.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Cucumis sativus] Length = 441 Score = 75.9 bits (185), Expect(2) = 8e-18 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +2 Query: 2 RGPTSRSSQYCGVTFYRRTDRWESHIWDCGKQVYLG 109 RGP SRSSQY GVTFYRRT RWESHIWDCGKQVYLG Sbjct: 130 RGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLG 165 Score = 39.3 bits (90), Expect(2) = 8e-18 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = +3 Query: 147 YDWAAITF*GIDAGISFHINEYEEDM 224 YD AAI F G+DA I+F+IN+Y+EDM Sbjct: 177 YDRAAIKFRGVDADINFNINDYDEDM 202 >ref|XP_002312046.1| AP2 domain-containing transcription factor [Populus trichocarpa] gi|222851866|gb|EEE89413.1| AP2 domain-containing transcription factor [Populus trichocarpa] Length = 506 Score = 75.9 bits (185), Expect(2) = 2e-17 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +2 Query: 2 RGPTSRSSQYCGVTFYRRTDRWESHIWDCGKQVYLG 109 RGP SRSSQY GVTFYRRT RWESHIWDCGKQVYLG Sbjct: 161 RGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLG 196 Score = 37.7 bits (86), Expect(2) = 2e-17 Identities = 16/26 (61%), Positives = 22/26 (84%) Frame = +3 Query: 147 YDWAAITF*GIDAGISFHINEYEEDM 224 YD AAI F G+DA I+F++++YEEDM Sbjct: 208 YDRAAIKFRGVDADINFNLSDYEEDM 233 >ref|XP_002275627.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like [Vitis vinifera] Length = 497 Score = 75.9 bits (185), Expect(2) = 2e-17 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +2 Query: 2 RGPTSRSSQYCGVTFYRRTDRWESHIWDCGKQVYLG 109 RGP SRSSQY GVTFYRRT RWESHIWDCGKQVYLG Sbjct: 157 RGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLG 192 Score = 37.7 bits (86), Expect(2) = 2e-17 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +3 Query: 147 YDWAAITF*GIDAGISFHINEYEEDM 224 YD AAI F G+DA I+F I++YEEDM Sbjct: 204 YDRAAIKFRGVDADINFSISDYEEDM 229 >ref|NP_001234647.1| AP2 transcription factor SlAP2d [Solanum lycopersicum] gi|333123373|gb|AEF28822.1| AP2 transcription factor SlAP2d [Solanum lycopersicum] Length = 496 Score = 75.9 bits (185), Expect(2) = 2e-17 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +2 Query: 2 RGPTSRSSQYCGVTFYRRTDRWESHIWDCGKQVYLG 109 RGP SRSSQY GVTFYRRT RWESHIWDCGKQVYLG Sbjct: 152 RGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLG 187 Score = 37.7 bits (86), Expect(2) = 2e-17 Identities = 16/26 (61%), Positives = 22/26 (84%) Frame = +3 Query: 147 YDWAAITF*GIDAGISFHINEYEEDM 224 YD AAI F G+DA I+F++++YEEDM Sbjct: 199 YDRAAIKFRGVDADINFNLSDYEEDM 224