BLASTX nr result
ID: Atractylodes21_contig00031356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031356 (473 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 62 6e-08 emb|CBI31022.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-lik... 59 3e-07 ref|XP_002330600.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002299051.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALDHYSPVLQHYPGVTEILKLIRREISGESLK 98 ALDHYSP+LQHYPG+ E+LKL+RRE+SGES+K Sbjct: 870 ALDHYSPILQHYPGIMEVLKLVRRELSGESVK 901 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 ALDHYSPVLQHYPGVTEILKLIRREISGESLK 98 ALDHYSP+LQHYPGV EILKL+RRE+S ES K Sbjct: 774 ALDHYSPILQHYPGVIEILKLVRRELSAESTK 805 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-like [Vitis vinifera] Length = 902 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 ALDHYSPVLQHYPGVTEILKLIRREISGESLK 98 ALDHYSP+LQHYPGV EILKL+RRE+S ES K Sbjct: 869 ALDHYSPILQHYPGVIEILKLVRRELSAESTK 900 >ref|XP_002330600.1| predicted protein [Populus trichocarpa] gi|222872158|gb|EEF09289.1| predicted protein [Populus trichocarpa] Length = 660 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +3 Query: 3 ALDHYSPVLQHYPGVTEILKLIRREISGESLK 98 ALDHYSP+L+HY G+TEILKL+RRE++GES+K Sbjct: 627 ALDHYSPILKHYSGITEILKLVRRELNGESMK 658 >ref|XP_002299051.1| predicted protein [Populus trichocarpa] gi|222846309|gb|EEE83856.1| predicted protein [Populus trichocarpa] Length = 848 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 3 ALDHYSPVLQHYPGVTEILKLIRREISGESLKA 101 ALDHYS +L+HYPG+TEILKLIRRE++GES+ A Sbjct: 790 ALDHYSLILKHYPGITEILKLIRRELNGESMTA 822