BLASTX nr result
ID: Atractylodes21_contig00031309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031309 (443 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521029.1| conserved hypothetical protein [Ricinus comm... 68 9e-10 emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] 59 3e-07 ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago ... 59 5e-07 >ref|XP_002521029.1| conserved hypothetical protein [Ricinus communis] gi|223539866|gb|EEF41446.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -3 Query: 225 KVKKLQKLIPGGKGLNADRLFVHTASYIMHLKLQVDVLQALSDVY 91 +VKKLQ+LIPGG+ L DRLF+ TA YI+HL+LQV+VLQALS++Y Sbjct: 42 RVKKLQRLIPGGEELQPDRLFLRTADYILHLELQVNVLQALSEIY 86 >emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] Length = 77 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 225 KVKKLQKLIPGGKGLNADRLFVHTASYIMHLKLQVDVL 112 KVKKLQ+LIPGG+GL DRLF+ TA YI+HL+LQ+ +L Sbjct: 25 KVKKLQRLIPGGRGLQPDRLFLRTADYILHLRLQMGIL 62 >ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|357516789|ref|XP_003628683.1| hypothetical protein MTR_8g063410 [Medicago truncatula] gi|355478488|gb|AES59691.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|355522705|gb|AET03159.1| hypothetical protein MTR_8g063410 [Medicago truncatula] Length = 72 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/45 (55%), Positives = 38/45 (84%) Frame = -3 Query: 225 KVKKLQKLIPGGKGLNADRLFVHTASYIMHLKLQVDVLQALSDVY 91 K+KKLQ++IPGG GL AD+LF+ TA +I+ L+LQ++ LQAL+ ++ Sbjct: 26 KMKKLQRIIPGGDGLKADQLFLRTAEHILQLRLQLNALQALTKIF 70