BLASTX nr result
ID: Atractylodes21_contig00031261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031261 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP93563.1| NAC [Cestrum nocturnum] 60 3e-08 gb|AAM34767.1|AF509867_1 nam-like protein 4 [Petunia x hybrida] 60 2e-07 gb|AAM34771.1|AF509871_1 nam-like protein 8 [Petunia x hybrida] 59 5e-07 >gb|AFP93563.1| NAC [Cestrum nocturnum] Length = 414 Score = 60.5 bits (145), Expect(2) = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +2 Query: 119 PSSFNAATLERSVPPGYLKFICYLEKEILNMSMERESLKIE 241 P +F+++ LE+SVPPGYLKFI LE E+LN SMERE+LKIE Sbjct: 331 PPTFDSSNLEKSVPPGYLKFISNLENEVLNGSMERETLKIE 371 Score = 21.9 bits (45), Expect(2) = 3e-08 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = +3 Query: 3 SEDSTTSKV*GSSTQPSYA-----LMEIPLLHSLKLKEGNPSR 116 SEDS TS +T + L PLL L+ KE PS+ Sbjct: 288 SEDSITSGQDHPTTMMTMTNYEPTLFGFPLLEPLEAKETQPSK 330 >gb|AAM34767.1|AF509867_1 nam-like protein 4 [Petunia x hybrida] Length = 406 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +2 Query: 125 SFNAATLERSVPPGYLKFICYLEKEILNMSMERESLKIE 241 +F+++ LE+SVPPGYLKFI LE EILN+SMERE+LKIE Sbjct: 336 TFDSSNLEKSVPPGYLKFISNLENEILNVSMERETLKIE 374 >gb|AAM34771.1|AF509871_1 nam-like protein 8 [Petunia x hybrida] Length = 392 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 119 PSSFNAATLERSVPPGYLKFICYLEKEILNMSMERESLKIE 241 P +F++A L +SVPPGYLKFI LE EILN+SME+E+LK+E Sbjct: 320 PPAFDSANLGKSVPPGYLKFISNLEHEILNVSMEKETLKLE 360