BLASTX nr result
ID: Atractylodes21_contig00031090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031090 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ70646.1| cytochrome c biogenesis protein [Helianthus annuus] 63 2e-08 >emb|CAJ70646.1| cytochrome c biogenesis protein [Helianthus annuus] Length = 206 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 302 IQPAHLLHCPQPFLVPRPKESGFVFFHRLVISFCLHTFL 418 IQP HLLHCPQPFLVP K++GF+FFHRLVI F + FL Sbjct: 158 IQPLHLLHCPQPFLVPLLKQNGFMFFHRLVIPFRSYLFL 196