BLASTX nr result
ID: Atractylodes21_contig00031027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00031027 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74933.1| hypothetical protein VITISV_044433 [Vitis vinifera] 57 2e-06 >emb|CAN74933.1| hypothetical protein VITISV_044433 [Vitis vinifera] Length = 606 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 8/68 (11%) Frame = +3 Query: 393 MGVCSSKPSTKTEFSGHQGTNIPVKGGDDGASGEAIS--------KKDEIEVGKKTPLFP 548 MG+C+SKPS SG + + +D A+ AIS +++E+E GKK+P FP Sbjct: 1 MGLCNSKPSPSPSVSGRKDDLVAQH--NDQAAAAAISVNGETPKNRREEVEAGKKSPFFP 58 Query: 549 FYSPSPAH 572 FYSPSPAH Sbjct: 59 FYSPSPAH 66