BLASTX nr result
ID: Atractylodes21_contig00030999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030999 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containi... 116 2e-24 ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containi... 116 2e-24 emb|CBI39641.3| unnamed protein product [Vitis vinifera] 116 2e-24 ref|XP_003623648.1| Pentatricopeptide repeat-containing protein ... 115 4e-24 ref|NP_001173399.1| Os03g0317100 [Oryza sativa Japonica Group] g... 113 1e-23 >ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Glycine max] Length = 711 Score = 116 bits (291), Expect = 2e-24 Identities = 52/59 (88%), Positives = 55/59 (93%) Frame = +1 Query: 1 LLKVPERMPIRIMKNLRVCGDCHSAFKLISQVMGREIILRDANRFHHFKDGLCSCKDYW 177 LLKVPE MPIR+MKNLRVCGDCHSA KLI++V GREIILRDANRFHHFKDG CSCKDYW Sbjct: 653 LLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGHCSCKDYW 711 >ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Vitis vinifera] Length = 703 Score = 116 bits (290), Expect = 2e-24 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +1 Query: 1 LLKVPERMPIRIMKNLRVCGDCHSAFKLISQVMGREIILRDANRFHHFKDGLCSCKDYW 177 LLKVPE MPIR+MKNLRVCGDCHSA KLI+++ GREIILRDANRFHHFKDG CSC+DYW Sbjct: 645 LLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 703 >emb|CBI39641.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 116 bits (290), Expect = 2e-24 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +1 Query: 1 LLKVPERMPIRIMKNLRVCGDCHSAFKLISQVMGREIILRDANRFHHFKDGLCSCKDYW 177 LLKVPE MPIR+MKNLRVCGDCHSA KLI+++ GREIILRDANRFHHFKDG CSC+DYW Sbjct: 193 LLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 251 >ref|XP_003623648.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498663|gb|AES79866.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 707 Score = 115 bits (288), Expect = 4e-24 Identities = 51/59 (86%), Positives = 55/59 (93%) Frame = +1 Query: 1 LLKVPERMPIRIMKNLRVCGDCHSAFKLISQVMGREIILRDANRFHHFKDGLCSCKDYW 177 LLKVPE MPIR+MKNLRVCGDCHSA KLI++V GREIILRDANRFHHFKDG CSCKD+W Sbjct: 649 LLKVPEGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGSCSCKDFW 707 >ref|NP_001173399.1| Os03g0317100 [Oryza sativa Japonica Group] gi|255674461|dbj|BAH92127.1| Os03g0317100 [Oryza sativa Japonica Group] Length = 706 Score = 113 bits (283), Expect = 1e-23 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = +1 Query: 1 LLKVPERMPIRIMKNLRVCGDCHSAFKLISQVMGREIILRDANRFHHFKDGLCSCKDYW 177 LLK+PE MPIR+MKNLRVCGDCHSA KLI+++ REIILRDANRFHHFKDG CSC+DYW Sbjct: 648 LLKIPEGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706