BLASTX nr result
ID: Atractylodes21_contig00030858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030858 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW81017.1| gag-pol polymerase [Arabidopsis lyrata subsp. lyr... 81 8e-14 >gb|ABW81017.1| gag-pol polymerase [Arabidopsis lyrata subsp. lyrata] Length = 1034 Score = 81.3 bits (199), Expect = 8e-14 Identities = 40/66 (60%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = -2 Query: 192 HYIQLTVFKVVNKV--VALISESFYMLDDDVAWWIDSGATSHVCKDRRWFTSLEPVENES 19 H Q +VF + +KV V+ I+E FY+ DD+VAWWIDSGAT HVCKDR WF + EPV++ S Sbjct: 235 HQGQNSVFDLHSKVYYVSKIAEVFYVQDDEVAWWIDSGATIHVCKDRGWFKTYEPVQDGS 294 Query: 18 VLRMGN 1 VL MGN Sbjct: 295 VLYMGN 300