BLASTX nr result
ID: Atractylodes21_contig00030843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030843 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595901.1| hypothetical protein MTR_2g063210 [Medicago ... 59 4e-07 ref|XP_003595909.1| hypothetical protein MTR_2g063300 [Medicago ... 58 7e-07 ref|XP_002520448.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_003595911.1| hypothetical protein MTR_2g063340 [Medicago ... 57 1e-06 ref|XP_003595908.1| hypothetical protein MTR_2g063290 [Medicago ... 57 1e-06 >ref|XP_003595901.1| hypothetical protein MTR_2g063210 [Medicago truncatula] gi|355484949|gb|AES66152.1| hypothetical protein MTR_2g063210 [Medicago truncatula] Length = 494 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/94 (38%), Positives = 49/94 (52%) Frame = +1 Query: 115 LKSPAKFMVTDDLVITPFSSLSAIALLNKLKVPFSDTKEQEVSIGIEEV*HS**ICLYIK 294 +K P MVTDDLV+TP SS+ A++ L ++KVP +D +E +SIG+EE Sbjct: 392 IKGPLTIMVTDDLVVTPMSSIDAVSYLERMKVPLNDVEEIFISIGVEE------------ 439 Query: 295 VCSILFFKNFLCYLQGLKILIASLLSCSTLSDVL 396 GL IL ASL S S L++ L Sbjct: 440 ---------------GLSILKASLTSTSALTNGL 458 >ref|XP_003595909.1| hypothetical protein MTR_2g063300 [Medicago truncatula] gi|355484957|gb|AES66160.1| hypothetical protein MTR_2g063300 [Medicago truncatula] Length = 476 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +1 Query: 115 LKSPAKFMVTDDLVITPFSSLSAIALLNKLKVPFSDTKEQEVSIGIEE 258 ++ P +VTDDLV+TP SS+ A++ L KLKVP D KE +SIG++E Sbjct: 374 VRGPLTILVTDDLVVTPISSIDAVSYLEKLKVPLDDLKEMVISIGVKE 421 >ref|XP_002520448.1| conserved hypothetical protein [Ricinus communis] gi|223540290|gb|EEF41861.1| conserved hypothetical protein [Ricinus communis] Length = 165 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +1 Query: 124 PAKFMVTDDLVITPFSSLSAIALLNKLKVPFSDTKEQEVSIGIEEV 261 PA F V DDL +TP S +S + +LNKLKVPFSD +E+ V +GIE+V Sbjct: 112 PAIFTVKDDLNVTPISPVSGVCVLNKLKVPFSDIEERTVDVGIEKV 157 >ref|XP_003595911.1| hypothetical protein MTR_2g063340 [Medicago truncatula] gi|355484959|gb|AES66162.1| hypothetical protein MTR_2g063340 [Medicago truncatula] Length = 447 Score = 57.4 bits (137), Expect = 1e-06 Identities = 34/94 (36%), Positives = 50/94 (53%) Frame = +1 Query: 115 LKSPAKFMVTDDLVITPFSSLSAIALLNKLKVPFSDTKEQEVSIGIEEV*HS**ICLYIK 294 L+ P FMVTDDLV++P S +S +A L ++KVP +D +E+ + IG++E Sbjct: 367 LRGPTSFMVTDDLVVSPMSLISGLAYLERMKVPLNDVEERVIRIGVKE------------ 414 Query: 295 VCSILFFKNFLCYLQGLKILIASLLSCSTLSDVL 396 GL IL ASL S S+L++ L Sbjct: 415 ---------------GLSILKASLTSTSSLTNGL 433 >ref|XP_003595908.1| hypothetical protein MTR_2g063290 [Medicago truncatula] gi|355484956|gb|AES66159.1| hypothetical protein MTR_2g063290 [Medicago truncatula] Length = 459 Score = 57.4 bits (137), Expect = 1e-06 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 5/119 (4%) Frame = +1 Query: 55 RITKYFENFKLNDLM-----VHERLLKSPAKFMVTDDLVITPFSSLSAIALLNKLKVPFS 219 R+ + NF+L + + + P FMVTDDLV+TP SS+S ++ L ++KVP + Sbjct: 354 RLPYHVRNFRLYKFVDPKSPISGGFSRGPLTFMVTDDLVVTPMSSISGVSYLERMKVPLN 413 Query: 220 DTKEQEVSIGIEEV*HS**ICLYIKVCSILFFKNFLCYLQGLKILIASLLSCSTLSDVL 396 D +E+ + IG +E GL+IL ASL + STL++ L Sbjct: 414 DVEERVIRIGRKE---------------------------GLRILKASLTTTSTLTNGL 445