BLASTX nr result
ID: Atractylodes21_contig00030701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030701 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273449.1| PREDICTED: UPF0308 protein At2g37240, chloro... 57 2e-06 ref|XP_002525198.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 ref|XP_002334170.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_002326159.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002273449.1| PREDICTED: UPF0308 protein At2g37240, chloroplastic [Vitis vinifera] gi|297741495|emb|CBI32627.3| unnamed protein product [Vitis vinifera] gi|342160850|gb|AEL16461.1| type II peroxiredoxin 2 [Vitis vinifera] Length = 254 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 407 MDASGVALVLIGPGSADQARAFSEQTSFKG 318 MDASGVALVLIGPGS DQA+AFSEQT+FKG Sbjct: 128 MDASGVALVLIGPGSIDQAKAFSEQTNFKG 157 >ref|XP_002525198.1| conserved hypothetical protein [Ricinus communis] gi|223535495|gb|EEF37164.1| conserved hypothetical protein [Ricinus communis] Length = 249 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 407 MDASGVALVLIGPGSADQARAFSEQTSFKG 318 MDASGVALVLIGPGS DQA+ FSEQT FKG Sbjct: 123 MDASGVALVLIGPGSVDQAKTFSEQTKFKG 152 >ref|XP_002334170.1| predicted protein [Populus trichocarpa] gi|222869935|gb|EEF07066.1| predicted protein [Populus trichocarpa] Length = 146 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 407 MDASGVALVLIGPGSADQARAFSEQTSFKG 318 MDASGVALVLIGPGS DQA+ FSEQT FKG Sbjct: 72 MDASGVALVLIGPGSVDQAKTFSEQTKFKG 101 >ref|XP_002326159.1| predicted protein [Populus trichocarpa] gi|222833352|gb|EEE71829.1| predicted protein [Populus trichocarpa] Length = 200 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 407 MDASGVALVLIGPGSADQARAFSEQTSFKG 318 MDASGVALVLIGPGS DQA+ FSEQT FKG Sbjct: 75 MDASGVALVLIGPGSVDQAKTFSEQTKFKG 104