BLASTX nr result
ID: Atractylodes21_contig00030657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030657 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532534.1| kinesin light chain, putative [Ricinus commu... 58 9e-07 >ref|XP_002532534.1| kinesin light chain, putative [Ricinus communis] gi|223527746|gb|EEF29850.1| kinesin light chain, putative [Ricinus communis] Length = 503 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = +3 Query: 21 DIKGEYLSCLKHLSTLLSKSGSNSLNRSRRPTLKEVENEIKRVEGELSTPNR 176 ++K EYLSCLK LSTL+S S + S +P+L+E+ +EIKR++G +S NR Sbjct: 444 EVKAEYLSCLKRLSTLISDSAVKEIKLSGKPSLQELNDEIKRIQGAISHHNR 495