BLASTX nr result
ID: Atractylodes21_contig00030323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030323 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77600.1| hypothetical protein VITISV_008038 [Vitis vinifera] 64 2e-08 ref|XP_003533580.1| PREDICTED: uncharacterized protein LOC100811... 63 3e-08 ref|XP_003551692.1| PREDICTED: uncharacterized protein LOC100802... 61 1e-07 dbj|BAJ53153.1| JHL23J11.8 [Jatropha curcas] 60 2e-07 ref|XP_002514782.1| chromatin assembly factor 1, subunit A, puta... 60 2e-07 >emb|CAN77600.1| hypothetical protein VITISV_008038 [Vitis vinifera] Length = 872 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 3 LQFDKSHRPAFYGHWPRKSEVVRARCPLVKDPELDY 110 LQFDKSHRPAFYG WP+KS++V RCP KD +LDY Sbjct: 498 LQFDKSHRPAFYGIWPKKSQIVGPRCPFKKDXDLDY 533 >ref|XP_003533580.1| PREDICTED: uncharacterized protein LOC100811035 [Glycine max] Length = 844 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = +3 Query: 3 LQFDKSHRPAFYGHWPRKSEVVRARCPLVKDPELDY 110 LQFDKSHRPAFYG WP KS VV AR PL KDP LDY Sbjct: 506 LQFDKSHRPAFYGVWPAKSHVVGARHPLRKDPSLDY 541 >ref|XP_003551692.1| PREDICTED: uncharacterized protein LOC100802884 [Glycine max] Length = 838 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +3 Query: 3 LQFDKSHRPAFYGHWPRKSEVVRARCPLVKDPELDY 110 LQFDKSHRPAFYG WP KS VV R PL KDP LDY Sbjct: 499 LQFDKSHRPAFYGVWPAKSHVVGPRHPLRKDPSLDY 534 >dbj|BAJ53153.1| JHL23J11.8 [Jatropha curcas] Length = 846 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 3 LQFDKSHRPAFYGHWPRKSEVVRARCPLVKDPELDY 110 LQFDKSHRPAFYG WP+KS VV R P K+P+LDY Sbjct: 501 LQFDKSHRPAFYGIWPKKSHVVGPRHPFRKEPDLDY 536 >ref|XP_002514782.1| chromatin assembly factor 1, subunit A, putative [Ricinus communis] gi|223545833|gb|EEF47336.1| chromatin assembly factor 1, subunit A, putative [Ricinus communis] Length = 823 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 3 LQFDKSHRPAFYGHWPRKSEVVRARCPLVKDPELDY 110 LQFDKSHRPAFYG WP+KS VV R P K+P+LDY Sbjct: 483 LQFDKSHRPAFYGIWPKKSHVVGPRHPFRKEPDLDY 518