BLASTX nr result
ID: Atractylodes21_contig00030213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030213 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 57 7e-08 emb|CAN80491.1| hypothetical protein VITISV_042679 [Vitis vinifera] 57 3e-07 emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera] 57 3e-07 emb|CAN81986.1| hypothetical protein VITISV_001568 [Vitis vinifera] 57 3e-07 gb|AAG51464.1|AC069160_10 gypsy/Ty3 element polyprotein, putativ... 59 5e-07 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 57.4 bits (137), Expect(2) = 7e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 30 LFSIHGIEFLMSSAYHPKTDGQTEVVNKCLETYLR 134 LF + G + MS AYHP+TDGQTEVVN+CLETYLR Sbjct: 1013 LFKLQGTKLKMSIAYHPETDGQTEVVNRCLETYLR 1047 Score = 23.9 bits (50), Expect(2) = 7e-08 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 1 PIFLSQFWKGSFPSMG 48 PIF+S FWK F G Sbjct: 1003 PIFMSNFWKELFKLQG 1018 >emb|CAN80491.1| hypothetical protein VITISV_042679 [Vitis vinifera] Length = 1412 Score = 57.0 bits (136), Expect(2) = 3e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 33 FSIHGIEFLMSSAYHPKTDGQTEVVNKCLETYLRGM 140 F + G+ +S+AYHP+TDGQTEVVN+C+ETYLR M Sbjct: 1171 FKLQGVSLQLSTAYHPQTDGQTEVVNRCIETYLRCM 1206 Score = 22.3 bits (46), Expect(2) = 3e-07 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 1 PIFLSQFWKGSFPSMGLS 54 PIF S FW+ F G+S Sbjct: 1160 PIFTSVFWQEFFKLQGVS 1177 >emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera] Length = 1371 Score = 57.0 bits (136), Expect(2) = 3e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 33 FSIHGIEFLMSSAYHPKTDGQTEVVNKCLETYLRGM 140 F + G+ +S+AYHP+TDGQTEVVN+C+ETYLR M Sbjct: 1196 FKLQGVSLQLSTAYHPQTDGQTEVVNRCIETYLRCM 1231 Score = 22.3 bits (46), Expect(2) = 3e-07 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 1 PIFLSQFWKGSFPSMGLS 54 PIF S FW+ F G+S Sbjct: 1185 PIFTSVFWQEFFKLQGVS 1202 >emb|CAN81986.1| hypothetical protein VITISV_001568 [Vitis vinifera] Length = 672 Score = 57.0 bits (136), Expect(2) = 3e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 33 FSIHGIEFLMSSAYHPKTDGQTEVVNKCLETYLRGM 140 F + G+ +S+AYHP+TDGQTEVVN+C+ETYLR M Sbjct: 334 FKLQGVSLQLSTAYHPQTDGQTEVVNRCIETYLRCM 369 Score = 22.3 bits (46), Expect(2) = 3e-07 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 1 PIFLSQFWKGSFPSMGLS 54 PIF S FW+ F G+S Sbjct: 323 PIFTSVFWQEFFKLQGVS 340 >gb|AAG51464.1|AC069160_10 gypsy/Ty3 element polyprotein, putative [Arabidopsis thaliana] Length = 1447 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 33 FSIHGIEFLMSSAYHPKTDGQTEVVNKCLETYLRGM 140 F + G+E MSSAYHP++DGQTEVVN+CLE YLR M Sbjct: 1204 FKLQGVELRMSSAYHPQSDGQTEVVNRCLENYLRCM 1239