BLASTX nr result
ID: Atractylodes21_contig00030046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00030046 (476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum] gi|... 57 1e-06 ref|XP_004142761.1| PREDICTED: protein kinase APK1A, chloroplast... 55 8e-06 >ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum] gi|189163920|gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum] Length = 401 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 11/81 (13%) Frame = +1 Query: 1 QYASGVATRAAILAMKCLAREPRYRPSAEELVKALEQLQELQKASDRCRK------EPAR 162 QY+ VA++ A LA++CL+++PR+RPS ++VK +EQL + K S R P R Sbjct: 316 QYSMEVASKVANLALRCLSKDPRFRPSMSDIVKEMEQLYQQSKESGNTRSHASNRPRPRR 375 Query: 163 KQ-----NGNKNVRYPRAVAS 210 + N N +V YPR AS Sbjct: 376 RSANDVANRNPSVAYPRPSAS 396 >ref|XP_004142761.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis sativus] gi|449527906|ref|XP_004170949.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis sativus] Length = 401 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/79 (41%), Positives = 46/79 (58%), Gaps = 8/79 (10%) Frame = +1 Query: 1 QYASGVATRAAILAMKCLAREPRYRPSAEELVKALEQLQELQKASDR--CRKEPARKQN- 171 QY++G A +AA LA++C++ EP+ RP+ +VKALEQLQ+ + S EP + Sbjct: 320 QYSTGGALKAAKLAIQCISTEPKLRPNMNAVVKALEQLQDSSETSGSRGTLSEPLNTSSQ 379 Query: 172 -----GNKNVRYPRAVASV 213 NK V YPR ASV Sbjct: 380 GSGSTNNKPVSYPRPSASV 398