BLASTX nr result
ID: Atractylodes21_contig00029959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029959 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 75 7e-12 ref|XP_003628497.1| NADH dehydrogenase subunit F [Medicago trunc... 74 2e-11 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 75.1 bits (183), Expect = 7e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 123 GSLISTPPVLVRSGPWSYVSGLPAYLLSEIDQPAGLVWLF 4 GSLISTPPVL+RSGPWS VSGLPA +SEIDQPAGLVWLF Sbjct: 37 GSLISTPPVLIRSGPWSSVSGLPADKISEIDQPAGLVWLF 76 >ref|XP_003628497.1| NADH dehydrogenase subunit F [Medicago truncatula] gi|355522519|gb|AET02973.1| NADH dehydrogenase subunit F [Medicago truncatula] Length = 187 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -1 Query: 123 GSLISTPPVLVRSGPWSYVSGLPAYLLSEIDQPAGLVWLF 4 GSLISTPPVL+RSGPWS VSG PA +SEIDQPAGLVWLF Sbjct: 19 GSLISTPPVLIRSGPWSSVSGFPADKISEIDQPAGLVWLF 58