BLASTX nr result
ID: Atractylodes21_contig00029952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029952 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [S... 58 7e-07 gb|ACF80884.1| unknown [Zea mays] gi|194705548|gb|ACF86858.1| un... 58 7e-07 ref|XP_003562412.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 58 9e-07 gb|ABL97970.1| cytochrome-c oxidase [Brassica rapa] 57 1e-06 gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] 57 2e-06 >ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] gi|241944051|gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] Length = 63 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +3 Query: 114 VIKEIGVGTVLGFICGGAWKYTYHYELKRRTKSFYNMLDKDEITVVVSE 260 V+KEI +G LG I GG WK +H+ +R+T+SFY+MLDK +I+VVV E Sbjct: 16 VVKEIFIGMTLGLIAGGMWKM-HHWNEQRKTRSFYDMLDKGQISVVVEE 63 >gb|ACF80884.1| unknown [Zea mays] gi|194705548|gb|ACF86858.1| unknown [Zea mays] gi|195605218|gb|ACG24439.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195608682|gb|ACG26171.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195610044|gb|ACG26852.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195618014|gb|ACG30837.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195655785|gb|ACG47360.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|414868438|tpg|DAA46995.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] gi|414878119|tpg|DAA55250.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] Length = 63 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +3 Query: 114 VIKEIGVGTVLGFICGGAWKYTYHYELKRRTKSFYNMLDKDEITVVVSE 260 V+KEI +G LG I GG WK +H+ +R+T+SFY+MLDK +I+VVV E Sbjct: 16 VVKEIFIGLTLGLIAGGMWKM-HHWNEQRKTRSFYDMLDKGQISVVVEE 63 >ref|XP_003562412.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] Length = 66 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 114 VIKEIGVGTVLGFICGGAWKYTYHYELKRRTKSFYNMLDKDEITVVVSE 260 V+KEI +G LG + GG WK +H+ +R+T+SFY+MLDK +I+VVV E Sbjct: 19 VVKEIFIGLTLGLVAGGMWKM-HHWNEQRKTRSFYDMLDKGQISVVVQE 66 >gb|ABL97970.1| cytochrome-c oxidase [Brassica rapa] Length = 63 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = +3 Query: 114 VIKEIGVGTVLGFICGGAWKYTYHYELKRRTKSFYNMLDKDEITVVVSE 260 V+KE+ +G LG GG WK +H+ +R+T++FY++LDKDEI+VVV+E Sbjct: 16 VVKELVIGLALGLAAGGLWKM-HHWNEQRKTRAFYDLLDKDEISVVVAE 63 >gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] Length = 77 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 114 VIKEIGVGTVLGFICGGAWKYTYHYELKRRTKSFYNMLDKDEITVVVSE 260 V+KEI +G LG I GG WK +H+ +R+T+SFY+MLDK +I+VVV + Sbjct: 16 VVKEIFIGLTLGLIAGGMWKM-HHWNEQRKTRSFYDMLDKGQISVVVED 63