BLASTX nr result
ID: Atractylodes21_contig00029945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00029945 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE22249.1| somatic embryogenesis receptor-like kinase 1 [Age... 66 1e-12 gb|AEG25668.1| somatic embryogenesis receptor-like kinase 3 prot... 60 2e-10 gb|AEA76434.1| somatic embryogenesis receptor-like kinase 2 prot... 60 2e-10 gb|ADT91693.1| BRI1-associated receptor kinase 1 [Nicotiana atte... 59 2e-10 gb|AAZ91738.1| leucine rich repeat protein 1 [Nicotiana tabacum] 59 2e-10 >gb|ADE22249.1| somatic embryogenesis receptor-like kinase 1 [Ageratina adenophora] Length = 617 Score = 66.2 bits (160), Expect(2) = 1e-12 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = -3 Query: 164 KLVNLQIYSTWSFSNYITGKILNELGKLTSFVSLDLYLNRLDGDIPNTLGNLKK 3 +L NLQ +SN ITGKI NELG LT+ VSLDLYLNRLDG IP TLG L+K Sbjct: 93 QLTNLQYLEL--YSNNITGKIPNELGNLTNLVSLDLYLNRLDGVIPETLGKLQK 144 Score = 31.6 bits (70), Expect(2) = 1e-12 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 204 DLGNAYLLGQLVPQIGQ 154 DLGNA L GQLVPQ+GQ Sbjct: 77 DLGNANLSGQLVPQLGQ 93 >gb|AEG25668.1| somatic embryogenesis receptor-like kinase 3 protein [Gossypium hirsutum] Length = 620 Score = 60.1 bits (144), Expect(2) = 2e-10 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = -3 Query: 161 LVNLQIYSTWSFSNYITGKILNELGKLTSFVSLDLYLNRLDGDIPNTLGNLKK 3 L NLQ +SN I+G I +ELG LT VSLDLYLN+L GDIP TLG LKK Sbjct: 94 LPNLQYLEL--YSNNISGTIPDELGNLTELVSLDLYLNKLTGDIPTTLGQLKK 144 Score = 30.0 bits (66), Expect(2) = 2e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 204 DLGNAYLLGQLVPQIG 157 DLGNA L GQLVPQ+G Sbjct: 77 DLGNANLTGQLVPQLG 92 >gb|AEA76434.1| somatic embryogenesis receptor-like kinase 2 protein [Gossypium hirsutum] Length = 620 Score = 60.1 bits (144), Expect(2) = 2e-10 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = -3 Query: 161 LVNLQIYSTWSFSNYITGKILNELGKLTSFVSLDLYLNRLDGDIPNTLGNLKK 3 L NLQ +SN I+G I +ELG LT VSLDLYLN+L GDIP TLG LKK Sbjct: 94 LPNLQYLEL--YSNNISGMIPDELGNLTELVSLDLYLNKLTGDIPTTLGQLKK 144 Score = 30.0 bits (66), Expect(2) = 2e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 204 DLGNAYLLGQLVPQIG 157 DLGNA L GQLVPQ+G Sbjct: 77 DLGNANLTGQLVPQLG 92 >gb|ADT91693.1| BRI1-associated receptor kinase 1 [Nicotiana attenuata] Length = 616 Score = 58.5 bits (140), Expect(2) = 2e-10 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -3 Query: 164 KLVNLQIYSTWSFSNYITGKILNELGKLTSFVSLDLYLNRLDGDIPNTLGNLKK 3 +L NLQ +SN I+G+I ELG LT+ VSLDLYLNRL+G IP+TLG L+K Sbjct: 93 QLPNLQYLEL--YSNNISGRIPFELGNLTNLVSLDLYLNRLNGPIPDTLGKLQK 144 Score = 31.6 bits (70), Expect(2) = 2e-10 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 204 DLGNAYLLGQLVPQIGQ 154 DLGNA L GQLVPQ+GQ Sbjct: 77 DLGNANLSGQLVPQLGQ 93 >gb|AAZ91738.1| leucine rich repeat protein 1 [Nicotiana tabacum] Length = 232 Score = 58.5 bits (140), Expect(2) = 2e-10 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = -3 Query: 164 KLVNLQIYSTWSFSNYITGKILNELGKLTSFVSLDLYLNRLDGDIPNTLGNLKK 3 +L NLQ +SN I+G+I ELG LT+ VSLDLYLNRL+G IP+TLG L+K Sbjct: 93 QLPNLQYLEL--YSNNISGRIPFELGNLTNLVSLDLYLNRLNGPIPDTLGKLQK 144 Score = 31.6 bits (70), Expect(2) = 2e-10 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 204 DLGNAYLLGQLVPQIGQ 154 DLGNA L GQLVPQ+GQ Sbjct: 77 DLGNANLSGQLVPQLGQ 93